SecReT4
Protein ID: 39937178
T4SS name [ID]Trb [334]
Gene symbol-
Locus tagRPA4118
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]4661500..4662795 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ6N2D2
KEGG IDrpa:RPA4118
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.4e-51, Aligned region: 37..261
Protein Sequence: 431 a.a.     [Download]
>gi|39937178|ref|NP_949454.1| conjugal transfer protein TrbL [Rhodopseudomonas palustris CGA009]
MGGTGVIDRFLAVFTQYIDSGFGLLQPEVAFVATTLIAIDITLAALFWSWGGDNDIIARLVKKTLFVGVF
AYLIGNWNKLARIIFESFSGLGLKAAGSGLSAADFLRPGRVAQVGLDAGRPLLEQISSLMGYIAFFENFI
QITVLLLAWVMVLLAFFILAIQLFVTLIEFKLTTLAGFVLIPFGLFGKSAFMAERVLGNVISSGIKVLVL
AVIVGIGSTLFSQFTSASATPPSIDDAMAMVLAALSLLGLGIFGPGIANGLVSGGPQLGAGSAVGAAAAG
GGVVAAGLAGTAMAGSGLAAAGGIAAGAARGGAALAGGATTAFRAGGASGLATTGLSKGAEAVTSPLRRA
AENLKSSFEAGGRAVAGEGSSAVAGGAASSSAASSAGEPPAWARRMKRAQTINHGTSAAAHAVRSGDHGG
GGASVNLSEGE
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c4662795-4661500 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGGGCGGCACCGGCGTCATCGATCGATTTCTCGCGGTCTTCACCCAATATATCGATAGCGGCTTCGGGC
TGCTGCAGCCCGAGGTGGCCTTTGTCGCCACCACGTTGATCGCCATCGATATCACGCTGGCGGCGCTGTT
CTGGAGCTGGGGCGGCGATAACGACATCATCGCGCGGCTGGTGAAGAAGACGCTGTTCGTCGGCGTCTTC
GCCTATCTGATCGGCAACTGGAACAAGCTCGCCCGGATCATCTTCGAGAGCTTCTCTGGTCTCGGCCTAA
AAGCCGCAGGCTCAGGACTTTCCGCCGCCGACTTCCTGCGCCCGGGCCGTGTCGCCCAGGTCGGGCTCGA
TGCCGGACGGCCGCTGTTGGAGCAGATCTCCAGCCTGATGGGCTACATCGCTTTCTTCGAGAATTTCATC
CAGATCACGGTCTTGCTGCTGGCCTGGGTGATGGTGCTGCTGGCGTTTTTCATCCTGGCGATCCAGCTGT
TCGTCACCCTGATCGAATTCAAGCTGACGACGCTCGCTGGCTTCGTGCTGATTCCCTTCGGCCTGTTCGG
CAAGTCCGCCTTCATGGCCGAGCGCGTGCTCGGCAACGTCATCTCGTCCGGCATCAAGGTGCTGGTGCTC
GCCGTCATCGTCGGCATCGGCTCGACGCTGTTTTCACAGTTCACATCGGCCTCAGCCACCCCGCCATCGA
TCGACGACGCCATGGCGATGGTGCTCGCTGCACTCTCGTTGCTCGGCCTCGGAATTTTCGGTCCCGGCAT
CGCCAATGGCCTTGTCTCCGGTGGTCCGCAGCTTGGCGCAGGCTCCGCTGTCGGCGCGGCCGCAGCGGGT
GGGGGCGTTGTTGCAGCAGGCCTTGCCGGCACCGCCATGGCTGGCAGCGGACTGGCCGCGGCTGGTGGCA
TTGCCGCCGGCGCCGCGCGCGGCGGCGCAGCACTGGCCGGCGGCGCCACGACAGCGTTTCGTGCCGGGGG
CGCATCGGGATTGGCAACGACCGGCCTCTCCAAAGGAGCGGAGGCTGTAACCAGCCCGCTGCGCCGCGCT
GCCGAAAACCTCAAGAGCAGTTTCGAGGCCGGAGGCCGAGCCGTGGCAGGTGAGGGGAGTTCGGCAGTCG
CCGGCGGAGCCGCATCATCCTCTGCGGCTTCATCCGCCGGCGAACCGCCGGCCTGGGCGCGCCGCATGAA
GCGCGCGCAAACCATCAACCACGGGACGTCCGCTGCCGCACACGCTGTTCGCTCCGGCGATCACGGCGGC
GGCGGAGCCTCCGTCAATCTCTCCGAGGGGGAATAG
 Primer design