SecReT4
Protein ID: 39937179
T4SS name [ID]Trb [334]
Gene symbol-
Locus tagRPA4119
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]4662799..4663185 [-]
ProductTrbK
Component typeTrbK
UniProt IDQ6N2D1
KEGG IDrpa:RPA4119
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|39937179|ref|NP_949455.1| TrbK [Rhodopseudomonas palustris CGA009]
MTARSQSRRLSIVVSVATLVLVVAACTIELRNQEQISSSAAPAAEQADPLAAELARCRTVTLEQTEALAK
CRQIWAERRRQFLKQKTAPTPTLTPTAVPNGNAAEVNSRKDESRVPQGGPSVSTGQGE
 
Nucleotide Sequence: 387 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c4663185-4662799 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGACCGCGCGCAGCCAATCCAGACGACTGTCGATTGTCGTGAGTGTCGCGACCTTGGTTCTGGTCGTCG
CAGCCTGCACCATCGAGCTGCGCAACCAGGAGCAGATCTCCTCGTCCGCAGCGCCTGCCGCCGAGCAGGC
TGATCCATTGGCGGCCGAACTCGCCCGCTGCCGGACGGTGACATTGGAGCAAACCGAAGCCCTTGCGAAG
TGTCGTCAGATCTGGGCCGAGCGGCGCCGCCAATTCCTCAAGCAGAAGACCGCACCAACTCCAACTCTCA
CTCCAACGGCAGTGCCGAACGGCAACGCCGCGGAGGTTAATTCGCGGAAGGACGAGAGCCGCGTGCCGCA
GGGGGGGCCATCAGTTTCCACCGGTCAGGGCGAATGA
 Primer design