SecReT4
Protein ID: 39937180
T4SS name [ID]Trb [334]
Gene symbol-
Locus tagRPA4120
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]4663182..4663919 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ6N2D0
KEGG IDrpa:RPA4120
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 1.2e-07, Aligned region: 13..47
Protein Sequence: 245 a.a.     [Download]
>gi|39937180|ref|NP_949456.1| conjugal transfer protein TrbJ [Rhodopseudomonas palustris CGA009]
MIRLRHLAAASVVALSLIVGAPPLSAQWVVFDPNNYAQNVLTAARELQQINNQITSLQNQAQMLINQARS
LASLPYSSLQQLESSIQRTQQLLAQAQNIAFNVQQIDHAFQTTYGSANASQSSQALIGNAQARWQNSVAA
LQDALRVQAGVIGNLDTNRTQMSALVTSSQAATGGLQATQAGNQLLALQAQQLGDLTAAVAAQGRAQSLQ
AAQQAAAQDQAREQLRRFLNPGTGYQPSNVAMFHP
 
Nucleotide Sequence: 738 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c4663919-4663182 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGATCAGGCTCCGTCATCTGGCGGCGGCGAGCGTCGTCGCATTGTCGCTCATCGTCGGCGCGCCGCCAC
TCTCGGCGCAGTGGGTCGTGTTCGACCCGAACAACTATGCGCAGAATGTTCTGACCGCGGCGCGCGAGCT
GCAACAGATCAACAACCAGATCACGTCGTTACAGAATCAGGCGCAGATGCTGATTAACCAGGCGCGCAGT
CTTGCGAGCCTGCCATATTCCTCACTGCAACAGCTGGAATCCTCGATCCAGCGCACCCAGCAGCTTCTCG
CGCAGGCGCAGAACATTGCCTTCAACGTCCAGCAGATCGATCATGCCTTTCAGACCACCTATGGCAGCGC
CAATGCGAGCCAATCCAGCCAGGCGCTGATCGGCAACGCCCAGGCGCGTTGGCAGAACTCGGTCGCAGCG
CTGCAGGATGCACTGCGCGTGCAAGCCGGCGTGATCGGCAATCTGGACACCAACCGCACCCAGATGTCGG
CCTTGGTGACCTCGAGCCAGGCGGCAACCGGCGGACTTCAGGCCACCCAAGCCGGCAACCAGTTGCTGGC
GTTGCAGGCGCAGCAACTCGGCGATCTCACCGCGGCAGTGGCCGCTCAGGGCCGCGCGCAGTCGCTTCAG
GCGGCCCAGCAGGCCGCGGCGCAAGATCAGGCCAGGGAGCAGCTCCGCCGCTTCCTCAACCCCGGCACCG
GCTATCAGCCCTCCAACGTGGCGATGTTTCATCCATGA
 Primer design