SecReT4
Protein ID: 39937181
T4SS name [ID]Trb [334]
Gene symboltrbE2
Locus tagRPA4121
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]4663916..4666357 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ6N2C9
KEGG IDrpa:RPA4121
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.9e-38, Aligned region: 443..716
CagE_TrbE_VirB [PF03135], Evalue: 7.7e-11, Aligned region: 182..389
Protein Sequence: 813 a.a.     [Download]
>gi|39937181|ref|NP_949457.1| conjugal transfer ATPase TrbE [Rhodopseudomonas palustris CGA009]
MMNLTEYRRSITHLGDFLPWAALVDEGIVLNKDGSFQRTAQFRGPDLDSAVPAELAGVASRLNNALRRFG
SGWAVFVEAQRYPANKYPEGHFPDVASALVDVERRAEFEREGAHYESGYFLTFLYLPPPEDTARTERFLY
EGRDRRHDEDARQVQRGFVDRTDRVLGLVEGFMPELKWLDDEETLTYLHSTVSTKRQRVRVPEIPMYLDA
LLADQPLTGGLEPMLGQSHLRVLTVVGFPTVTTPGILDELNRLAFAYRWATRAIMLDKTDATRLLTKIRR
QWFAKRKSIAAILKEVMTNEASTLLDSDAHNKALDADAALQELGSDAIGQAFVTATVTVWDDDPRIADEK
LRLVEKVIQGRDFTCMVESVNAVEAWLGSLPGHAYANVRQPPVSTLNLAHMIPLSAVWAGPARDEHLGAP
ALFFGRTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYPHNQIFAFDFGGSIRAAALAM
GGDWHDLGGDLTDGASSSLSLQPLSRIPDVPERAWAADWIVNILSREGITTTPEVKEHLWSALTSLASAP
DTERTLTGLSVLLQAQALKRALQPYCIGGASGRLLDAETERLGDAPVQVFETEGLIGTAAAPAVLAYLFH
RIEHRLDGRPTLLIIDEGWLALDDEGFAGQVREWLKTLRKKNASVVFATQSLSDIDNSEIAPAIIESCPT
RLLLPNERAIEPQISAVYQRFGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLGAIALAFCAASSKAD
QAMIARVLAEHRRDGFVSEWLRRRDAGWAADLIPELRNLEFPT
 
Nucleotide Sequence: 2442 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c4666357-4663916 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGATGAACCTCACTGAGTATCGTCGATCGATAACCCATCTTGGCGATTTCTTGCCCTGGGCTGCTCTGG
TCGATGAGGGCATCGTTCTCAACAAGGACGGCTCGTTTCAGCGAACCGCGCAGTTTCGGGGACCGGATCT
GGATTCCGCGGTGCCGGCGGAACTGGCCGGCGTCGCCAGCCGGCTGAACAACGCGTTGCGCCGGTTCGGG
TCGGGCTGGGCGGTGTTTGTCGAAGCACAAAGATACCCCGCCAACAAATATCCCGAGGGCCATTTTCCGG
ATGTCGCGTCAGCGCTGGTCGATGTCGAGCGCCGCGCCGAATTCGAGCGGGAAGGGGCGCATTACGAGTC
AGGCTATTTCCTGACCTTCCTCTATCTGCCGCCGCCGGAAGACACCGCACGCACCGAGAGATTCCTCTAC
GAGGGACGCGACCGCCGTCATGACGAGGATGCTCGGCAAGTGCAACGCGGCTTCGTTGATCGCACCGACC
GGGTGCTCGGGCTTGTCGAGGGCTTCATGCCCGAACTCAAATGGCTCGATGACGAGGAGACGCTGACTTA
TCTGCATTCGACCGTCTCGACCAAGCGCCAGCGCGTCCGCGTTCCCGAGATCCCGATGTATCTCGACGCT
CTGCTGGCCGACCAGCCTCTCACCGGTGGCCTCGAGCCGATGCTGGGACAGTCCCATCTGCGGGTGCTGA
CGGTCGTCGGGTTTCCGACGGTGACCACCCCCGGCATTTTGGACGAGCTCAACCGGCTCGCGTTCGCCTA
CCGCTGGGCGACCCGCGCCATCATGCTCGACAAAACCGACGCGACCAGGCTGCTGACCAAAATCCGCCGG
CAATGGTTCGCCAAGCGCAAATCGATCGCCGCAATCCTGAAGGAGGTGATGACCAACGAAGCCTCGACAC
TGCTAGATAGCGATGCCCACAACAAGGCCTTGGATGCCGATGCGGCATTGCAGGAACTCGGATCCGATGC
CATCGGCCAGGCGTTCGTCACCGCAACCGTCACGGTGTGGGACGACGACCCTCGCATCGCGGACGAAAAG
CTCCGCCTCGTGGAGAAGGTGATCCAGGGACGCGATTTCACCTGCATGGTGGAGAGCGTCAACGCGGTCG
AAGCTTGGCTCGGATCGCTACCCGGCCATGCCTATGCCAACGTCCGACAGCCGCCGGTCTCGACGCTCAA
CCTCGCGCACATGATCCCGCTGTCCGCGGTCTGGGCCGGCCCTGCGCGAGACGAGCATTTGGGCGCCCCG
GCATTGTTCTTCGGCAGGACCGAAGGCGCAACGCCGTTTCGGTTCTCACTTCACGTCGGCGACGTCGGCC
ATACCCTGGTGGTCGGTCCGACCGGCGCCGGCAAGTCGGTGTTGCTGGCACTGATGGCGCTGCAATTCCG
GCGCTATCCGCACAATCAGATCTTTGCTTTTGACTTCGGCGGCTCGATCCGCGCCGCGGCGCTGGCAATG
GGCGGCGACTGGCACGATCTCGGCGGCGATCTGACCGACGGCGCCTCAAGCTCTCTTTCACTGCAGCCAC
TGTCGCGCATCCCCGATGTTCCCGAGCGCGCCTGGGCCGCGGATTGGATCGTCAACATCCTGTCCCGCGA
GGGCATCACCACCACACCGGAGGTGAAAGAGCATCTGTGGTCGGCGCTGACCTCGCTGGCCTCGGCGCCG
GACACTGAACGCACGCTGACCGGCCTGTCGGTGCTGCTGCAGGCGCAGGCGCTAAAGCGCGCGCTGCAGC
CCTATTGCATTGGTGGGGCGTCTGGTCGGTTGCTCGACGCTGAGACCGAACGGCTCGGAGATGCCCCGGT
GCAGGTGTTCGAGACCGAAGGGCTGATCGGCACGGCCGCCGCGCCCGCGGTTCTCGCCTATCTGTTCCAT
CGCATTGAACACCGCCTTGATGGCCGGCCGACGCTGTTGATCATCGACGAAGGCTGGCTGGCGCTGGATG
ACGAGGGCTTTGCCGGCCAGGTCCGGGAGTGGCTGAAGACGTTACGGAAGAAGAACGCCTCCGTGGTGTT
CGCCACCCAGTCATTGTCCGACATCGACAATTCGGAGATTGCGCCCGCCATCATCGAAAGTTGTCCGACG
CGGCTGTTGTTGCCGAACGAGCGCGCCATCGAGCCGCAAATATCCGCCGTCTATCAGCGCTTCGGTCTCA
ACGACCGCCAGATCGAGATTCTGGCGCGCGCCACGCCGAAGCGCGATTATTACTGCCAGTCGCGCCGCGG
CAACCGGCTGTTCGAGCTCGGCCTCGGCGCGATTGCTCTCGCCTTCTGCGCGGCGTCCTCCAAGGCCGAC
CAGGCCATGATCGCGCGCGTGCTCGCCGAGCATAGGCGGGACGGTTTCGTGAGCGAATGGCTGCGCCGGC
GCGACGCGGGCTGGGCCGCCGACCTCATCCCTGAGCTTCGCAACCTGGAGTTTCCAACATGA
 Primer design