SecReT4
Protein ID: 39937182
T4SS name [ID]Trb [334]
Gene symbol-
Locus tagRPA4122
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]4666367..4666630 [-]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDQ6N2C8
KEGG IDrpa:RPA4122
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 9.6e-11, Aligned region: 10..78
Protein Sequence: 87 a.a.     [Download]
>gi|39937182|ref|NP_949458.1| conjugal transfer protein TrbD [Rhodopseudomonas palustris CGA009]
MEEMIPGFAAPVHRALTEHILLGGAPRAVAILNGTLAAALGLGLRLWLAGLVLAILGHAAAVWAAKRDPL
FVDVVRRHLRIPGHLSV
 
Nucleotide Sequence: 264 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c4666630-4666367 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGGAGGAGATGATCCCTGGCTTTGCAGCGCCGGTTCATCGCGCGCTCACCGAACACATCCTGCTCGGCG
GCGCGCCGCGTGCGGTGGCGATCCTCAACGGCACCTTGGCCGCGGCGCTTGGCCTTGGCCTGCGGTTGTG
GCTCGCCGGTCTGGTGCTCGCAATTCTCGGTCACGCCGCCGCGGTCTGGGCGGCGAAGCGCGATCCGCTG
TTCGTCGATGTGGTGCGCCGCCATCTGCGCATCCCCGGTCATCTTTCCGTTTGA
 Primer design