SecReT4
Protein ID: 39937183
T4SS name [ID]Trb [334]
Gene symboltrbC2
Locus tagRPA4123
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]4666630..4666974 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ6N2C7
KEGG IDrpa:RPA4123
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9e-22, Aligned region: 14..104
Protein Sequence: 114 a.a.     [Download]
>gi|39937183|ref|NP_949459.1| conjugal transfer protein TrbC [Rhodopseudomonas palustris CGA009]
MIHRPPPLRRAMARTAAFASLTTILTTWPGATAWAAGSSMPWEQPLNQILQSVEGPVAKIMAVIIIIVTG
LTLAFGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 345 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c4666974-4666630 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGATCCATCGTCCGCCCCCACTTCGTCGCGCCATGGCGAGGACCGCCGCCTTCGCAAGCCTGACCACGA
TACTGACAACGTGGCCCGGTGCGACTGCCTGGGCTGCCGGCTCCAGCATGCCGTGGGAGCAACCGCTCAA
CCAGATCCTGCAATCGGTCGAAGGTCCGGTCGCCAAGATCATGGCGGTGATCATCATCATCGTCACCGGA
CTGACGCTGGCGTTCGGCGATACGTCGGGCGGCTTTCGCCGGCTGATACAGATCGTGTTCGGTCTGTCGA
TCGCGTTTGCGGCGAGCTCCTTCTTCCTCTCGTTTTTCTCCTTCGGCGGCGGAGCGCTGGTCTGA
 Primer design