SecReT4
Protein ID: 39937184
T4SS name [ID]Trb [334]
Gene symboltrbB2
Locus tagRPA4124
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]4666971..4667939 [-]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDQ6N2C6
KEGG IDrpa:RPA4124
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.2e-84, Aligned region: 26..290
Protein Sequence: 322 a.a.     [Download]
>gi|39937184|ref|NP_949460.1| conjugal transfer protein TrbB [Rhodopseudomonas palustris CGA009]
MTGITQQSAAIMRGARMLRTALGPAIAGFLEDPSVVEVMLNPDGRLWIDRLSAGLFDTGERLNAADGDRI
VRLVAHHVGAEVHAGSPRVSAELPETGERFEGLLPPVVTAPTFAIRKPAVAVFTLDDYVAAGIMSAGQAT
ALREGVAARANILVAGGTSTGKTTLTNALLAEVAKSGDRVVLIEDTRELQCLAPNLVALRTKDGVVSLSD
LVRASLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGVGTIHAGSALGALRRLEQLIQEAVITVPRALIA
ETIDVVAVLSGRGSERRLTELMRVTGLGPAGDYALSPAGDRS
 
Nucleotide Sequence: 969 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c4667939-4666971 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGACGGGTATCACTCAGCAATCGGCAGCGATCATGCGTGGTGCGCGCATGCTGCGTACGGCGCTCGGGC
CAGCGATCGCCGGCTTCCTGGAGGACCCATCGGTCGTCGAGGTGATGCTTAACCCCGACGGGCGGCTCTG
GATCGACCGGCTTTCCGCAGGGCTCTTCGATACAGGAGAACGTCTCAACGCCGCCGACGGCGATCGGATC
GTGCGCCTGGTCGCCCACCACGTCGGCGCCGAGGTTCACGCTGGTAGTCCCCGCGTCTCGGCTGAATTGC
CCGAGACCGGTGAGCGGTTCGAAGGGCTGCTGCCGCCGGTGGTCACCGCGCCGACCTTTGCGATCCGCAA
ACCGGCTGTCGCTGTGTTTACGCTCGATGACTATGTGGCTGCCGGCATCATGTCCGCCGGGCAGGCCACG
GCGCTGCGCGAGGGCGTCGCGGCGCGCGCAAACATCCTCGTCGCCGGCGGGACCTCGACCGGCAAGACCA
CGCTCACCAATGCGCTGCTCGCCGAGGTCGCCAAATCGGGCGATCGTGTGGTGCTCATCGAGGACACCCG
TGAGCTGCAATGTCTGGCGCCCAATCTGGTGGCGCTTCGGACCAAGGACGGTGTGGTGTCGCTGTCGGAT
CTGGTGCGTGCCTCGCTTCGCCTGCGCCCCGACCGCATCCCGATCGGAGAGGTTCGCGGCGCCGAGGCAC
TGGACCTGTTGAAGGCTTGGGGCACCGGACACCCCGGCGGCGTCGGCACCATCCACGCCGGCAGCGCGCT
CGGCGCGTTGCGCCGTCTCGAACAGCTAATCCAGGAAGCCGTCATCACCGTCCCGCGCGCCTTGATCGCC
GAGACCATCGACGTCGTTGCGGTGCTGTCCGGCCGCGGATCGGAGCGCCGGCTCACAGAGCTGATGCGCG
TCACCGGGCTCGGGCCGGCCGGCGACTACGCCCTTTCACCCGCAGGAGATCGATCATGA
 Primer design