SecReT4
Protein ID: 39937192
T4SS name [ID]Trb [334]
Gene symboltraG1
Locus tagRPA4132
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]4672894..4674888 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ6N2B8
KEGG IDrpa:RPA4132
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.6e-98, Aligned region: 113..556
TraG-D_C [PF12696], Evalue: 1.7e-30, Aligned region: 402..523
TrwB_AAD_bind [PF10412], Evalue: 2.6e-25, Aligned region: 195..537
AAA_10 [PF12846], Evalue: 2.5e-07, Aligned region: 147..479
Protein Sequence: 664 a.a.     [Download]
>gi|39937192|ref|NP_949468.1| conjugal transfer coupling protein TraG [Rhodopseudomonas palustris CGA009]
MSGTRILWGQIAIVLTVVMTTTWTATQWTAWRLGFQPQLGQPWFELAPGMPVYYPPAFFWWWYAFDAYAP
AVFVEGAFIAASGGFIAIAVAITLSVLRAREAKSVETYGSARWASEREIRGAGLLGPNGVILGCHGEHYL
RHDGPEHVLCFAPTRSGKGVGLVVPTLLTWPGSTIVHDIKGENWTLTAGFRSRFGRVLKFDPTDALSAAY
NPLLEVRRGDKEVRDVQNIADILVDPEGALDRRNHWEKTSHSLLVGAILHVLYAEPDKTLAGVANFLSDP
KRPVEATLRAMMSTPHLGASGVHPVVASAARELLNKSDNERSGVLSTAMSFLGLYRDPVVAKVTERCDWR
IADLIAQRASLSLYLVVPPSDINRTKPLIRLILNQIGRRLTEELNTGGRRHRLLLMLDEFPALGRLDFFE
SALAFMAGYGIKSFLIAQSLNQIEKAYGANNSVLDNCHVRVAFATNDERTAKRVSDALGTATELRDSTNY
AGHRLAPWLGHLMVSRQETARPLLTPGEVMQLSPADELLLVSGVHPIRARKARYYEDRRLAERILPPPVL
GKIVRQGSDMTAHDWLALPQLTAAVPRQAQDGQLVGDPANGGIRREPELPQHEEIVPNQQPADREFDVLE
EGPDIDAAKARALRQGVRIVARQAAMDPADGIGL
 
Nucleotide Sequence: 1995 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c4674888-4672894 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGTCGGGAACACGTATCCTTTGGGGTCAGATCGCAATCGTCCTTACCGTCGTGATGACGACAACGTGGA
CCGCGACGCAATGGACGGCTTGGCGGCTCGGCTTTCAGCCCCAGCTTGGGCAACCGTGGTTTGAACTGGC
ACCCGGCATGCCGGTCTACTACCCGCCGGCGTTCTTCTGGTGGTGGTATGCCTTCGACGCCTACGCGCCC
GCGGTCTTTGTCGAAGGGGCGTTTATCGCGGCCTCCGGCGGATTTATCGCCATCGCGGTTGCCATCACTC
TGTCGGTCCTAAGAGCGCGCGAAGCGAAAAGCGTCGAGACCTACGGCTCAGCCCGCTGGGCCTCCGAACG
AGAAATCCGTGGCGCGGGATTGCTCGGTCCCAACGGCGTCATCCTCGGTTGCCACGGCGAGCACTATTTG
CGTCATGACGGACCGGAACATGTGCTGTGCTTTGCACCCACAAGGTCCGGCAAAGGCGTCGGCCTGGTCG
TCCCGACGCTGCTAACCTGGCCCGGCAGCACGATCGTTCACGACATTAAGGGAGAGAATTGGACGCTGAC
GGCCGGCTTCCGGTCACGGTTCGGCCGCGTGCTAAAATTCGATCCGACCGACGCGCTCTCCGCCGCCTAC
AATCCGCTGCTGGAGGTGCGGCGAGGGGACAAGGAGGTGCGCGACGTTCAGAATATTGCCGACATCCTGG
TCGATCCGGAAGGCGCACTCGATCGCCGCAATCATTGGGAGAAGACCAGCCATAGCCTTCTCGTCGGCGC
CATCCTGCACGTCCTTTATGCGGAACCGGACAAGACGCTGGCCGGGGTCGCCAACTTCCTGTCCGACCCA
AAGCGCCCGGTCGAAGCCACGCTGCGCGCCATGATGTCGACGCCGCACCTTGGTGCGAGCGGCGTTCATC
CCGTGGTCGCCTCTGCCGCCCGCGAACTCTTGAACAAGTCGGACAACGAACGCTCCGGCGTGCTCTCCAC
CGCGATGTCGTTTCTCGGCCTCTACCGCGATCCCGTGGTGGCCAAGGTGACCGAGCGCTGCGATTGGCGG
ATTGCCGATCTCATCGCGCAGCGGGCATCGCTCAGCCTTTACCTCGTGGTGCCGCCCTCCGACATCAACC
GCACCAAGCCGCTGATCCGGTTGATCCTCAACCAGATCGGGCGGCGGCTCACGGAGGAATTGAACACCGG
CGGTCGCCGGCATCGCTTGCTGCTGATGCTCGACGAATTTCCCGCCCTGGGACGCCTGGATTTCTTTGAA
TCGGCACTCGCCTTCATGGCCGGCTATGGCATCAAGAGCTTCTTGATCGCGCAATCGCTCAACCAGATCG
AAAAAGCCTACGGCGCCAATAATTCCGTGTTGGATAATTGCCACGTCCGGGTCGCCTTCGCCACCAACGA
CGAACGGACCGCGAAACGCGTCTCGGATGCACTGGGCACCGCGACCGAACTGCGCGATTCCACCAATTAT
GCGGGCCACCGGTTGGCGCCCTGGCTTGGCCATCTGATGGTGTCGCGACAGGAGACGGCGCGGCCGCTGT
TGACACCCGGCGAGGTGATGCAGCTTTCCCCCGCCGACGAATTGCTGCTGGTTTCCGGTGTCCATCCGAT
CCGTGCCAGGAAAGCGCGCTACTACGAGGATCGCCGCCTGGCGGAGCGCATCCTGCCGCCGCCGGTCCTC
GGTAAGATTGTTCGGCAAGGCTCCGATATGACGGCGCACGATTGGCTCGCGTTGCCGCAACTCACCGCCG
CGGTCCCGCGTCAGGCCCAAGATGGTCAACTCGTCGGTGACCCCGCTAACGGTGGCATTAGGCGCGAGCC
GGAGTTGCCCCAGCATGAGGAGATCGTACCAAACCAACAACCGGCCGATCGCGAATTCGACGTGCTGGAG
GAGGGGCCTGACATCGATGCGGCCAAGGCCCGAGCGTTGCGTCAAGGCGTGCGCATCGTGGCGCGGCAGG
CGGCGATGGATCCCGCCGATGGCATCGGGCTGTGA
 Primer design