SecReT4
Protein ID: 41056981
T4SS name [ID]Tra_F [103]
Gene symboltraL
Locus tagpC15-1a_056
StrainEscherichia coli plasmid pC15-1a (NC_005327)
Repliconplasmid pC15-1a [GenBank: NC_005327] [Browse all T4SS(s) in this replicon]
Location [Strand]52857..53168 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDQ6SJ25
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 5.8e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|41056981|ref|NP_957601.1| conjugal transfer pilus assembly protein TraL [Escherichia coli]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICVGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|41056927|ref|NC_005327.1|:52857-53168 Escherichia coli plasmid pC15-1a, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTGTTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design