SecReT4
Protein ID: 41057000
T4SS name [ID]Tra_F [103]
Gene symboltraF
Locus tagpC15-1a_075
StrainEscherichia coli plasmid pC15-1a (NC_005327)
Repliconplasmid pC15-1a [GenBank: NC_005327] [Browse all T4SS(s) in this replicon]
Location [Strand]66640..67401 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ6SJ06
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.4e-79, Aligned region: 29..243
Protein Sequence: 253 a.a.     [Download]
>gi|41057000|ref|NP_957620.1| conjugal pilus assembly protein TraF [Escherichia coli]
MMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQTATKR
ALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQR
QAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVK
YFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 762 bp     [Download]
>gi|41056927|ref|NC_005327.1|:66640-67401 Escherichia coli plasmid pC15-1a, complete sequence
ATGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGT
CAGGGAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCTGT
ACCTGCAGCCCCCCGTCAGGAGCCGGATATTATGCAGAAACTGGCCGCGCTGCAGACGGCAACAAAGCGG
GCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTTAAATATTTCCGGCTGCAGAATTACT
GGACTCAGCAGGCCGGGCTTTTCACCATGAGTGCTAAAAAGGCCATGCTGGCACATCCCGAACTGGACTA
TAACCTGCAGTACAGCCATTACAACGGCACGGTACGGAACCAGCTGGCGGCAGACCAGGCGCAGCAGCGA
CAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTCTTTTACCGGGGGCAGGACCCCATCGACG
GGCAACTGGCGCAGGTCATTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTATTCCCGTTTCCGTGGA
TGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGTGTGAAA
TATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCATACGGCTTTATTT
CACAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAATTTTTAA
 Primer design