SecReT4
Protein ID: 41057002
T4SS name [ID]Tra_F [103]
Gene symboltraQ
Locus tagpC15-1a_077
StrainEscherichia coli plasmid pC15-1a (NC_005327)
Repliconplasmid pC15-1a [GenBank: NC_005327] [Browse all T4SS(s) in this replicon]
Location [Strand]67878..68162 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDQ6SJ04
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 5.7e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|41057002|ref|NP_957622.1| conjugal transfer pilin chaperone TraQ [Escherichia coli]
MISKYRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSLE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|41056927|ref|NC_005327.1|:67878-68162 Escherichia coli plasmid pC15-1a, complete sequence
ATGATAAGTAAATACAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCACGTGTCAGCCTGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design