SecReT4
Protein ID: 41223309
T4SS name [ID]VirB [19]
Gene symbolvirB8
Locus tagAtu6174
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid Ti [GenBank: NC_003065] [Browse all T4SS(s) in this replicon]
Location [Strand]189531..190244 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDP17798
KEGG IDatu:Atu6174
PDB ID2CC3
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.2e-41, Aligned region: 23..227
Protein Sequence: 237 a.a.     [Download]
>gi|41223309|ref|NP_396495.2| component of type IV secretion system [Agrobacterium tumefaciens str. C58]
MKGSEYALLVARETLAEHYKEVEAFQTARAKSARRLSKVIAAVATIAVLGNVAQAFTIATMVPLIRLVPV
YLWIRPDGTVDSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPMVRQNYQQFF
NYPNPTSPQVILGKHGRLEVEHIASNDVTPGVQQIRYKRTLIVDGKMPMASTWTATVRYEKVTSLPGRLR
LTNPGGLVVTSYQTSEDTVSNAGHSEP
 
Nucleotide Sequence: 714 bp     [Download]
>gi|159161952|ref|NC_003065.3|:189531-190244 Agrobacterium tumefaciens str. C58 plasmid Ti, complete sequence
ATGAAGGGGTCTGAATACGCCTTGCTAGTAGCGCGGGAAACCCTGGCTGAGCACTACAAGGAAGTGGAAG
CTTTCCAAACTGCGCGTGCGAAATCAGCGCGGCGCCTCTCCAAGGTCATTGCAGCTGTCGCAACCATCGC
GGTTTTGGGGAATGTTGCGCAAGCCTTCACAATTGCCACCATGGTGCCGCTGATCAGGCTTGTGCCGGTA
TATCTTTGGATACGGCCGGATGGCACCGTTGACAGCGAGGTGTCCGTCTCCCGATTGCCTGCAACTCAAG
AGGAGGCCGTCGTTAACGCCTCACTGTGGGAGTATGTTCGGCTGCGCGAGAGCTATGATGCCGATACCGC
CCAGTATGCCTATGACCTGGTCTCGAACTTCAGCGCCCCAATGGTGCGCCAAAATTATCAGCAATTCTTC
AATTATCCCAATCCAACTTCGCCTCAAGTCATCCTCGGCAAACACGGCAGGCTAGAGGTCGAACACATCG
CTTCGAATGATGTTACTCCGGGTGTGCAGCAAATTCGCTATAAGCGAACCCTCATCGTTGACGGCAAAAT
GCCGATGGCGAGCACTTGGACTGCTACGGTTCGTTATGAAAAGGTGACCAGCTTGCCCGGCAGATTGAGA
CTGACCAACCCGGGAGGCTTGGTTGTCACCTCCTACCAGACATCGGAAGATACCGTTTCGAACGCAGGCC
ACAGCGAACCATGA
 Primer design