SecReT4
Protein ID: 41223310
T4SS name [ID]VirB [19]
Gene symbolvirB11
Locus tagAtu6177
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid Ti [GenBank: NC_003065] [Browse all T4SS(s) in this replicon]
Location [Strand]192293..193327 [+]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDP07169
KEGG IDatu:Atu6177
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4e-59, Aligned region: 12..310
Protein Sequence: 344 a.a.     [Download]
>gi|41223310|ref|NP_396498.2| component of type IV secretion system [Agrobacterium tumefaciens str. C58]
MEVDPQLRILLKPILEWLDDPRTEEVAINRPGEAFVRQAGAFLKFPLPVSYDDLEDIAILAGALRKQDVG
PRNPLCATELPDGERLQICLPPTVPSGTVSLTIRRPSSRVSSLKEVSSRYDAPRWNQWKERKKRHDQHDE
AILRYYDNGDLEAFLHACVVGRLTMLLCGPTGSGKTTMSKTLINAIPPQERLITIEDTLELVIPHENHVR
LLYSKNGAGLGAVTAEHLLQASLRMRPDRILLGEIRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKL
FSLVKSSAQGASLEDRTLIDMLATAVDVIVPFRAHGDIYEVGEIWLAADARRRGETIGDLLNQQ
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|159161952|ref|NC_003065.3|:192293-193327 Agrobacterium tumefaciens str. C58 plasmid Ti, complete sequence
ATGGAGGTGGATCCGCAATTACGAATCCTTCTCAAGCCGATTTTGGAATGGCTCGATGACCCGCGGACCG
AAGAAGTTGCGATAAATCGACCTGGGGAGGCATTTGTGCGCCAGGCCGGCGCCTTCCTCAAGTTCCCTTT
GCCTGTCTCCTATGACGATCTCGAAGATATCGCTATTTTAGCAGGCGCGCTGAGAAAACAGGACGTTGGA
CCACGCAACCCACTTTGCGCAACTGAACTTCCAGACGGCGAGCGGCTGCAGATCTGTTTGCCGCCGACGG
TACCATCGGGCACCGTCAGCTTGACGATTCGACGGCCAAGTTCCCGTGTTTCTAGTCTCAAAGAAGTCTC
GTCCCGTTACGATGCTCCGAGGTGGAATCAGTGGAAGGAACGAAAAAAACGGCATGATCAGCATGATGAA
GCTATCCTTCGGTACTATGACAACGGGGATCTGGAGGCGTTTCTGCACGCATGTGTCGTTGGTCGGTTGA
CGATGCTGCTTTGCGGACCCACCGGGAGTGGCAAGACAACGATGAGCAAGACCTTGATCAACGCTATCCC
GCCGCAGGAAAGGCTGATTACCATCGAAGATACGCTCGAACTCGTCATTCCACACGAGAACCACGTAAGG
CTGCTTTATTCTAAGAATGGGGCTGGGCTGGGCGCAGTTACCGCTGAGCACCTGCTACAGGCTAGCCTGC
GCATGCGACCGGACCGAATACTGCTCGGCGAGATACGCGACGATGCCGCGTGGGCTTATCTGAGTGAAGT
CGTCTCAGGGCATCCGGGATCGATTTCCACAATACATGGTGCCAATCCCGTCCAAGGTTTCAAAAAGCTA
TTTTCGCTCGTGAAAAGCAGCGCTCAGGGGGCTAGCTTGGAAGATCGCACCCTGATTGACATGCTCGCAA
CCGCAGTTGATGTCATCGTACCCTTCCGTGCCCACGGTGACATTTACGAGGTGGGCGAAATCTGGCTCGC
TGCCGATGCGCGTCGGCGCGGTGAGACAATAGGCGATCTTCTTAACCAGCAGTAG
 Primer design