SecReT4
Protein ID: 41223312
T4SS name [ID]VirB [19]
Gene symbolvirD4
Locus tagAtu6184
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid Ti [GenBank: NC_003065] [Browse all T4SS(s) in this replicon]
Location [Strand]199956..201962 [+]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDP18594
KEGG IDatu:Atu6184
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.6e-160, Aligned region: 97..537
TraG-D_C [PF12696], Evalue: 5.7e-28, Aligned region: 391..509
TrwB_AAD_bind [PF10412], Evalue: 6.7e-24, Aligned region: 138..522
AAA_10 [PF12846], Evalue: 1.2e-07, Aligned region: 140..467
Protein Sequence: 668 a.a.     [Download]
>gi|41223312|ref|NP_396505.2| virA/G regulated protein [Agrobacterium tumefaciens str. C58]
MNSSKTTPQRLAVSIVCSLAAGFCAASLYVTFRHGFNGEAMMTFSVFAFWYETPLYMGHATPVFYCGLAI
VVSTSIVVLLSQLIISFRNHEHHGTARWAGFGEMRHAGYLQRYNRIKGPIFGKTCGPRWFGSYLTNGEQP
HSLVVAPTRAGKGVGVVIPTLLTFKGSVIALDVKGELFELTSRARKAGGDAVFKFSPLDPERRTHCYNPV
LDIAALPPERQFTETRRLAANLITAKGKGAEGFIDGARDLFVAGILTCIERGTPTIGAVYDLFAQPGEKY
KLFAHLAEESRNKEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLVKAATSRSDFSVYDLRRKRTC
VYLCVSPNDLEVVAPLMRLLFQQVVSILQRSLPGKDERHEVLFLLDEFKHLGKLEAIETAITTIAGYKGR
FMFIIQSLSALTGIYDDAGKQNFLSNTGVQVFMATADDETPTYISKAIGDYTFKARSTSYSQARMFDHNI
QISDQGAPLLRPEQVRLLDDNNEIVLIKGHPPLKLRKVRYYSDRMLRRLFECQIGALPEPASLMLSEGVH
RDGQDLSQQAAVTEAQGLGDIDSIPNNMEAATPQNSEMDDEQDSLPTGIDVPQGLIESDEVKEDAGGVVP
DFGVSAEMAPAMIAQQQLLEQIIALQQRYGPASSHSVK
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|159161952|ref|NC_003065.3|:199956-201962 Agrobacterium tumefaciens str. C58 plasmid Ti, complete sequence
ATGAATTCGAGCAAGACTACGCCCCAGCGTTTAGCTGTCAGCATCGTATGTTCGCTGGCAGCCGGTTTTT
GCGCGGCAAGTCTCTATGTAACATTTCGCCATGGTTTCAATGGCGAAGCGATGATGACGTTTAGCGTCTT
CGCCTTTTGGTACGAGACCCCGCTCTATATGGGTCATGCGACCCCCGTCTTCTATTGCGGTTTAGCCATT
GTCGTCTCGACGTCTATTGTTGTGCTGTTAAGCCAACTTATCATATCGTTTCGCAATCACGAGCATCATG
GCACGGCTCGTTGGGCGGGATTTGGCGAAATGCGGCACGCCGGTTACCTGCAGCGCTATAATCGTATCAA
GGGGCCAATCTTTGGCAAGACGTGTGGCCCTCGTTGGTTCGGCAGCTATCTGACCAATGGCGAACAGCCT
CACAGTCTTGTTGTCGCGCCAACGCGCGCCGGCAAAGGCGTTGGCGTCGTTATTCCGACGCTCCTAACCT
TCAAGGGTTCGGTGATAGCCCTCGACGTCAAAGGCGAGCTTTTTGAGCTGACTTCCAGAGCACGCAAAGC
GGGCGGCGACGCCGTTTTCAAGTTCTCGCCTCTGGATCCAGAGCGACGGACTCATTGTTACAATCCCGTC
CTCGATATTGCAGCTTTACCGCCCGAGCGGCAGTTTACCGAGACGCGCCGCCTCGCCGCAAACCTCATCA
CGGCCAAAGGCAAGGGAGCGGAAGGCTTTATCGACGGCGCGCGGGACCTTTTCGTTGCGGGCATCCTTAC
CTGTATTGAGCGCGGTACGCCAACAATTGGTGCGGTCTACGACTTATTTGCTCAACCTGGAGAGAAGTAC
AAACTTTTTGCGCACCTCGCGGAAGAAAGCCGAAATAAAGAGGCTCAGCGCATTTTCGACAATATGGCGG
GTAACGACACGAAAATTTTGACTTCTTATACATCAGTGCTCGGCGACGGCGGACTTAACCTGTGGGCTGA
TCCATTGGTTAAAGCAGCGACAAGTCGATCAGATTTTTCCGTCTATGATCTGCGTCGGAAGAGGACCTGC
GTCTATCTTTGCGTCAGTCCCAACGACCTCGAGGTCGTGGCGCCATTGATGCGCCTCCTTTTTCAGCAGG
TCGTGTCAATTCTGCAGCGATCACTGCCAGGTAAAGATGAGCGGCATGAAGTTTTGTTTCTCCTTGACGA
ATTTAAACACCTGGGGAAGCTTGAGGCAATCGAGACCGCGATTACAACCATCGCCGGTTACAAAGGCCGC
TTCATGTTTATTATTCAGAGTCTCTCGGCCTTGACGGGCATCTACGATGACGCGGGCAAACAAAACTTTC
TCAGTAACACTGGCGTGCAAGTATTTATGGCCACGGCCGACGACGAAACACCGACCTATATCTCAAAAGC
TATCGGCGACTATACGTTCAAGGCGCGTTCGACCTCATACAGTCAAGCCCGAATGTTCGATCATAACATC
CAGATTTCCGATCAGGGGGCACCGCTTTTGCGCCCCGAACAAGTGCGCTTGCTTGACGATAACAATGAAA
TCGTCCTTATTAAAGGGCATCCGCCTCTCAAACTACGAAAGGTGCGATATTATTCCGATCGTATGCTGAG
GCGCCTTTTCGAATGCCAAATTGGCGCCCTCCCTGAGCCCGCATCTTTGATGCTTTCGGAAGGTGTCCAT
CGGGATGGGCAAGACCTCAGTCAACAAGCCGCCGTCACGGAGGCGCAGGGCTTAGGTGACATCGATTCGA
TACCTAATAATATGGAAGCCGCTACACCGCAAAACAGTGAAATGGATGACGAGCAGGACAGCCTCCCAAC
TGGAATTGACGTCCCCCAGGGCCTTATTGAAAGCGATGAGGTGAAAGAAGACGCCGGTGGCGTGGTGCCA
GATTTCGGTGTTTCAGCTGAAATGGCTCCAGCTATGATTGCACAACAGCAGCTGCTGGAGCAGATCATTG
CGCTTCAGCAACGATATGGACCCGCGTCCTCGCACTCGGTGAAATGA
 Primer design