SecReT4
Protein ID: 41223323
T4SS name [ID]Trb [245]
Gene symboltrbG
Locus tagAtu6033
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid Ti [GenBank: NC_003065] [Browse all T4SS(s) in this replicon]
Location [Strand]43375..44229 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ7D2P9
KEGG IDatu:Atu6033
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.9e-59, Aligned region: 68..281
Protein Sequence: 284 a.a.     [Download]
>gi|41223323|ref|NP_396550.2| conjugal transfer protein [Agrobacterium tumefaciens str. C58]
MNIQLRRFSATLTAATIVAVIVPFSASLSSRALAADGVTANEAKGMGISGQWRGSRGLVTKGPDGKVIFL
YGEVQPSVVCSPLQVCDIELQGGEVVRDVLVGDTVRWKVEPATSGAAGGQAIHLIVKPSEPNLVTSMVVT
TSRRTYHIQLKSHANQYMARVGFEYPEDVSARLADINARMEANTIPGAGVPAEQLSFSYSVSGSAGWRPT
RLYSDGEKTYIQFPRSISGQDAPVLFVVSGGQNRIVNYRMKGDMMIVDYNVDRAVLVSGVGWKQEKVTIR
RGGR
 
Nucleotide Sequence: 855 bp     [Download]
>gi|159161952|ref|NC_003065.3|:c44229-43375 Agrobacterium tumefaciens str. C58 plasmid Ti, complete sequence
ATGAACATTCAACTCAGACGTTTTTCGGCCACGCTGACTGCTGCAACGATCGTCGCCGTCATCGTGCCGT
TTTCGGCTTCTCTTTCCTCCCGCGCGCTCGCGGCCGATGGCGTCACAGCCAACGAAGCGAAGGGCATGGG
GATATCCGGACAGTGGCGCGGCAGTCGCGGCCTCGTGACGAAAGGACCGGACGGAAAGGTGATCTTCCTC
TATGGAGAAGTGCAGCCGTCCGTGGTCTGCTCGCCCTTGCAGGTTTGCGACATCGAGCTTCAGGGCGGCG
AGGTGGTCCGCGACGTGCTGGTCGGCGACACGGTTCGCTGGAAGGTCGAGCCTGCAACCTCGGGCGCTGC
CGGCGGGCAGGCGATCCACCTGATCGTCAAGCCGTCGGAGCCAAACCTCGTCACCTCTATGGTGGTGACG
ACCTCGCGGCGCACCTATCACATCCAGCTCAAGTCGCATGCAAACCAATATATGGCGCGCGTCGGCTTCG
AATATCCGGAAGACGTCTCCGCCAGGCTCGCCGACATCAATGCGCGAATGGAGGCGAACACCATTCCAGG
CGCCGGCGTTCCGGCTGAGCAGCTCAGTTTTTCCTATTCCGTCTCAGGCAGCGCCGGCTGGCGGCCGACG
CGCCTCTATTCGGACGGGGAGAAGACCTACATCCAGTTCCCGCGCTCGATCTCCGGCCAGGACGCGCCGG
TCCTCTTCGTGGTCTCCGGTGGGCAGAACCGCATCGTCAACTACCGGATGAAGGGAGATATGATGATCGT
TGACTATAACGTCGACCGTGCGGTCCTCGTCTCCGGCGTCGGCTGGAAACAGGAGAAAGTGACGATCCGA
CGGGGAGGGCGGTGA
 Primer design