SecReT4
Protein ID: 42519923
T4SS name [ID]VirB [494]
Gene symbol-
Locus tagWD0004
StrainWolbachia endosymbiont of Drosophila melanogaster
Repliconchromosome [GenBank: NC_002978] [Browse all T4SS(s) in this replicon]
Location [Strand]4300..4980 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDQ73IY8
KEGG IDwol:WD0004
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.6e-55, Aligned region: 19..224
Protein Sequence: 226 a.a.     [Download]
>gi|42519923|ref|NP_965838.1| type IV secretion system protein VirB8 [Wolbachia endosymbiont of Drosophila melanogaster]
MLRFFKREKNTESLDKDINWNSNRYSTVIAQRNILLLFALILLATISISILVIFKISTSSTIEPFVIEID
KKSGIVQLVDPVTVKQYSADEALNDYFISEYIKAREVFDPYHYNYNYYTKVRLFSSPDVYNEFRNYVGSQ
NMDDLFNLYSDTKSEFKIRSIQKLGNDALQVRFFVEFTRKDGSSTRKNKIVIMSYRYASLEMDNQQRYIN
PLGFQVISYRVDDEYV
 
Nucleotide Sequence: 681 bp     [Download]
>gi|42519920|ref|NC_002978.6|:4300-4980 Wolbachia endosymbiont of Drosophila melanogaster, complete genome
ATGCTAAGATTTTTTAAGCGAGAAAAAAATACTGAATCCTTAGATAAGGATATAAATTGGAATTCAAACC
GCTACAGCACAGTTATTGCTCAAAGGAATATTCTACTTTTATTTGCATTAATATTATTAGCAACGATCTC
TATCAGCATATTAGTCATATTTAAAATTAGCACAAGTAGCACTATTGAGCCATTTGTTATAGAAATTGAC
AAGAAATCAGGAATAGTGCAATTGGTTGATCCTGTCACAGTAAAACAGTATTCTGCAGATGAAGCGCTAA
ACGATTATTTTATTTCAGAGTATATAAAAGCAAGGGAGGTTTTTGATCCATATCATTATAATTATAACTA
TTATACAAAGGTGAGGTTGTTTTCCTCACCTGATGTGTATAATGAATTTAGAAATTATGTAGGATCGCAG
AATATGGATGATCTTTTTAATTTATATTCAGATACCAAAAGTGAATTTAAAATTCGCTCAATTCAAAAGT
TGGGTAACGATGCTCTTCAGGTGAGATTTTTTGTGGAATTTACACGGAAAGATGGAAGTTCTACGAGAAA
AAATAAGATAGTTATTATGTCATATAGATATGCATCGCTTGAAATGGATAATCAGCAAAGATATATTAAC
CCATTAGGATTTCAAGTTATTTCATATAGAGTAGATGATGAATATGTATAG
 Primer design