SecReT4
Protein ID: 42519926
T4SS name [ID]VirB [494]
Gene symbol-
Locus tagWD0007
StrainWolbachia endosymbiont of Drosophila melanogaster
Repliconchromosome [GenBank: NC_002978] [Browse all T4SS(s) in this replicon]
Location [Strand]7246..8238 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ73IY5
KEGG IDwol:WD0007
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.4e-88, Aligned region: 11..310
Protein Sequence: 330 a.a.     [Download]
>gi|42519926|ref|NP_965841.1| type IV secretion system ATPase VirB11 [Wolbachia endosymbiont of Drosophila melanogaster]
MNYAALDTYLEPLQGIFQEEGVNEISINKPKEVWIENRGEIRCEKLEVFDLNHLKSLGRLIAQATEQKLS
EEAPLLSATLPNGYRIQIVFPPACEPDKVVMSIRKPSSMQLALDDYEKMGAFSETVTEATDNPVDRHLDL
LLRQKKIKEFLEYAVISKKNIIISGGTSTGKTTFTNATLRAIPDEERIITVEDAREIVLNDHPNKVHLIA
SKGGQGRAKVTTQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADSPTMALEQIKLM
VMQANLGIPPDQIIPYIRNVIDIVIQLKRTGGGKRSISEILFTRSASENA
 
Nucleotide Sequence: 993 bp     [Download]
>gi|42519920|ref|NC_002978.6|:7246-8238 Wolbachia endosymbiont of Drosophila melanogaster, complete genome
ATGAACTATGCTGCACTTGATACATATTTGGAGCCATTACAAGGCATATTTCAAGAAGAAGGCGTAAATG
AAATATCAATAAATAAGCCAAAGGAAGTATGGATTGAAAATCGCGGTGAAATAAGGTGTGAAAAATTAGA
AGTATTCGATCTTAACCATTTGAAATCTCTTGGCAGACTGATTGCTCAAGCTACAGAACAAAAACTTAGC
GAAGAAGCGCCGTTACTTTCGGCAACATTACCAAATGGTTATCGTATACAGATAGTATTTCCGCCAGCAT
GTGAACCTGATAAAGTAGTCATGTCGATTCGTAAGCCTTCTAGCATGCAGTTAGCACTCGATGATTACGA
AAAAATGGGGGCTTTTTCTGAAACTGTTACAGAAGCAACTGATAATCCAGTTGACCGTCATTTGGATTTA
TTGTTAAGGCAAAAAAAAATAAAAGAGTTTTTAGAATACGCTGTAATAAGTAAGAAAAATATTATAATTA
GTGGTGGAACTTCCACTGGTAAGACTACTTTTACTAATGCTACTTTGCGTGCTATTCCAGATGAGGAAAG
AATTATTACTGTTGAGGATGCAAGGGAAATCGTTTTGAACGATCATCCCAATAAAGTCCATCTAATTGCC
TCTAAAGGAGGGCAGGGCAGAGCAAAAGTAACCACTCAAGATTTGATAGAAGCGTGCTTACGTTTAAGGC
CAGACAGAATAATAGTTGGTGAGCTCCGTGGAGCGGAAGCTTTTAGTTTTCTTAGGGCGATAAATACTGG
TCACCCTGGATCAATATCAACCCTTCATGCGGATAGTCCAACAATGGCCCTTGAGCAAATAAAACTGATG
GTTATGCAAGCAAACCTTGGCATTCCTCCAGACCAAATTATACCATACATTAGAAATGTGATTGATATTG
TTATTCAGCTAAAAAGAACCGGTGGGGGCAAAAGAAGCATTTCTGAGATATTATTTACTAGATCTGCGAG
TGAAAATGCTTAA
 Primer design