SecReT4
Protein ID: 42519927
T4SS name [ID]VirB [494]
Gene symbol-
Locus tagWD0008
StrainWolbachia endosymbiont of Drosophila melanogaster
Repliconchromosome [GenBank: NC_002978] [Browse all T4SS(s) in this replicon]
Location [Strand]8269..10215 [+]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDQ73IY4
KEGG IDwol:WD0008
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.5e-150, Aligned region: 123..566
TraG-D_C [PF12696], Evalue: 2e-26, Aligned region: 406..528
TrwB_AAD_bind [PF10412], Evalue: 2.6e-25, Aligned region: 239..542
Protein Sequence: 648 a.a.     [Download]
>gi|42519927|ref|NP_965842.1| type IV secretion system component VirD4 [Wolbachia endosymbiont of Drosophila melanogaster]
MSNRNHLRNILIGGVVAFSVLEFCFYLSGILFVLFADGPDAVDFKAINPSLTPFPQALWPTIFNHIQYCW
HHPELYSLELKITLIISSALPIIVLMIILWNLRERIIEWRPFKKKESLHGDSQWASEKDIRKAGLRSKKG
LLLGKDKRGYFISDRFQHALLFAPTGSGKGVGFVIPNLLFWTDSVIVHDIKLENYEITSGWRERQGQKVY
VWNPAQPDGISHCYNPLQWISEKPGQMVDDVQKIANLIMPEQDFWQNEARSLFVGVVLYLLAAPEKVKSF
GEVVRTMRSDDVVYNLAVALDTMGKILHPVAYMNIAAFLQKADKERSGVVSTMNSSLELWVNPLIDTATA
SSDFNILDFKKKKITVYVGLTPDNLTRLRPLMQVFYQQATEFLCRKLPSDDEPYGVLFLMDEFPTLGKME
QFQTGIAYFRGYRVRLFLIVQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTVQQ
ESLNKPKFLDLNPASRSLHISEIQRALLLPQEVIMLPRDDQIILIESTYPIKSKKILYYSDTTFTRRLLK
QTRVPTQEPYDPNKVLSAAASKDKVNNEGNNVLEGPNSVDYPAETKTEDAVYDESDEFADEDIDDEDIDD
KFEDDDEEDEDKLKNDEK
 
Nucleotide Sequence: 1947 bp     [Download]
>gi|42519920|ref|NC_002978.6|:8269-10215 Wolbachia endosymbiont of Drosophila melanogaster, complete genome
ATGAGTAATAGAAATCACCTACGTAATATTCTCATAGGAGGTGTAGTAGCTTTTAGCGTACTTGAGTTTT
GCTTCTATCTATCTGGTATATTGTTTGTTCTGTTTGCTGATGGTCCGGATGCTGTGGATTTTAAGGCAAT
TAATCCTAGTTTGACGCCTTTCCCTCAAGCTCTTTGGCCAACGATTTTTAATCATATACAATATTGTTGG
CATCATCCAGAGTTATATAGCCTTGAGCTCAAAATCACATTAATTATATCTTCTGCACTGCCTATCATTG
TTTTAATGATTATCTTATGGAATTTAAGAGAAAGGATAATTGAGTGGCGACCATTTAAAAAGAAGGAATC
ACTTCATGGAGATTCGCAGTGGGCATCAGAGAAAGACATACGAAAAGCAGGATTAAGAAGCAAAAAGGGA
TTATTGCTTGGTAAAGATAAAAGAGGATACTTCATTTCTGATAGGTTTCAGCATGCATTGTTATTTGCAC
CTACAGGTTCTGGTAAGGGTGTTGGCTTTGTAATTCCTAATTTATTATTTTGGACTGACTCGGTAATTGT
ACACGACATAAAATTAGAAAACTATGAAATAACAAGTGGTTGGCGAGAACGACAAGGACAAAAAGTATAC
GTATGGAATCCAGCGCAGCCAGATGGAATAAGTCACTGTTACAATCCATTACAATGGATTAGTGAAAAAC
CTGGGCAGATGGTTGACGATGTGCAGAAAATAGCTAACCTAATCATGCCTGAACAAGACTTTTGGCAGAA
TGAAGCAAGAAGCTTATTTGTTGGAGTGGTATTATACTTACTTGCTGCACCAGAGAAAGTTAAATCTTTT
GGTGAAGTTGTGCGTACGATGCGTAGTGATGACGTGGTTTATAATCTTGCTGTTGCTCTTGATACAATGG
GTAAAATACTACACCCTGTAGCATATATGAATATTGCAGCTTTTTTACAAAAAGCTGATAAAGAAAGGTC
AGGTGTTGTATCAACCATGAACTCATCACTTGAATTGTGGGTAAACCCATTGATTGATACTGCAACTGCG
TCAAGTGATTTTAATATTCTAGATTTTAAAAAGAAGAAAATTACAGTTTATGTTGGTTTAACTCCTGACA
ACTTGACTAGGCTCAGGCCTTTAATGCAGGTTTTTTACCAACAGGCAACTGAGTTTTTATGTAGAAAATT
GCCATCGGATGACGAGCCTTATGGCGTATTGTTTTTAATGGATGAGTTTCCTACACTTGGAAAAATGGAG
CAATTTCAAACAGGTATTGCATATTTTCGTGGTTATCGAGTTAGGTTATTCTTAATTGTTCAAGATACTG
AGCAGCTCAAAGGAATATACGAAGAAGCAGGGATGAACTCCTTTTTGTCAAACTCGACTTACAGAATAAC
TTTTGCAGCCAATAATATTGAAACAGCTAATTTAATATCGCAACTTATAGGAAACAAAACTGTACAACAA
GAATCGTTGAATAAGCCTAAATTTTTAGATTTAAATCCTGCTTCAAGGTCATTACATATCTCTGAAATAC
AGAGAGCATTGCTATTGCCTCAAGAAGTTATTATGTTGCCACGTGACGATCAGATAATTTTAATAGAGTC
GACTTACCCAATTAAATCAAAGAAAATTTTGTACTACAGTGATACCACCTTCACAAGAAGGCTGCTCAAA
CAAACTCGTGTGCCTACACAAGAACCATATGACCCAAATAAAGTTCTTTCTGCCGCTGCGAGCAAAGATA
AGGTTAATAACGAGGGGAATAATGTTCTTGAGGGACCTAATTCAGTTGATTATCCTGCTGAAACTAAAAC
CGAAGATGCAGTATATGATGAATCAGATGAATTTGCAGACGAAGATATTGATGATGAAGATATCGACGAT
AAGTTTGAAGATGATGACGAGGAAGATGAGGATAAATTAAAAAATGACGAGAAGTAA
 Primer design