SecReT4
Protein ID: 45476512
T4SS name [ID]VirB [410]
Gene symbolvirB8
Locus tagYP_pCRY13
StrainYersinia pestis biovar Microtus str. 91001
Repliconplasmid pCRY [GenBank: NC_005814] [Browse all T4SS(s) in this replicon]
Location [Strand]9622..10305 [+]
Producttype IV secretion system VirB8 component
Component typeVirB8
UniProt IDQ74YT5
KEGG IDypm:YP_pCRY13
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.2e-51, Aligned region: 10..222
Protein Sequence: 227 a.a.     [Download]
>gi|45476512|ref|NP_995427.1| type IV secretion system VirB8 component [Yersinia pestis biovar Microtus str. 91001]
MSEQKLIAESRTFEQQMIERDKRATKAGFVVGGVGLLIAVLALVAVVVMLPLKQTDVELYTVDNHTGRVE
HVTRTSKTSLTATEAYQKAMAANYVKVRERYVYPSLQDDYETVQVYNAPQVNDDYLALYAGKNAPDKVYK
NGAHTVKVEILSNQITDATAPDRVATIRYKKIIRRLADNSTRNEYWDARFTFHSDPDKEMSDAEREINYF
GFTVTSWQTDREIRGGE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|45476499|ref|NC_005814.1|:9622-10305 Yersinia pestis biovar Microtus str. 91001 plasmid pCRY, complete sequence
ATGAGTGAACAGAAATTAATAGCTGAATCCCGCACCTTTGAGCAGCAAATGATTGAGCGGGATAAACGCG
CCACGAAAGCCGGTTTTGTTGTTGGCGGCGTGGGTCTGCTGATTGCGGTACTGGCGCTCGTCGCCGTGGT
CGTGATGTTGCCGCTGAAACAGACGGACGTTGAGCTGTATACCGTGGATAACCATACAGGACGGGTGGAA
CACGTTACCCGGACATCGAAAACCAGCCTGACCGCAACAGAAGCCTATCAAAAGGCGATGGCCGCAAACT
ACGTCAAAGTGCGTGAGCGGTATGTCTATCCCTCTTTGCAGGACGACTACGAGACGGTACAGGTCTACAA
CGCTCCCCAGGTAAACGATGACTATCTGGCGCTTTATGCCGGAAAAAACGCCCCGGACAAGGTTTATAAG
AACGGGGCGCACACCGTGAAAGTGGAGATCTTGTCCAACCAGATCACCGATGCGACAGCCCCTGATAGGG
TCGCCACCATCCGCTACAAGAAGATTATCCGCCGTCTGGCTGATAACAGCACCCGCAACGAATATTGGGA
TGCCCGGTTCACATTCCATTCTGACCCTGACAAGGAAATGAGCGATGCGGAACGCGAGATCAACTACTTC
GGCTTTACCGTCACCAGTTGGCAGACCGACCGCGAAATCCGGGGAGGTGAATGA
 Primer design