SecReT4
Protein ID: 45476515
T4SS name [ID]VirB [410]
Gene symbolvirB11
Locus tagYP_pCRY16
StrainYersinia pestis biovar Microtus str. 91001
Repliconplasmid pCRY [GenBank: NC_005814] [Browse all T4SS(s) in this replicon]
Location [Strand]12494..13519 [+]
Producttype IV secretory pathway VirB11 component
Component typeVirB11
UniProt IDQ74YT2
KEGG IDypm:YP_pCRY16
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.7e-46, Aligned region: 18..279
Protein Sequence: 341 a.a.     [Download]
>gi|45476515|ref|NP_995430.1| type IV secretory pathway VirB11 component [Yersinia pestis biovar Microtus str. 91001]
MTAKNISLDRYKQRFFGDFLELPGLTEIAVNRPGELYTKINGVWEQHAVPLSYEDCYNFARCLAKHHGDN
IEDIKPGLSATLESGERCQVIVPPACERDTVSITIRKPSKVQIPHQSYIDAGFYNRVTGEEKTETHDEEL
IALYNTKNIPLFMEKCVEYGKTLAVAGETSTGKTTYMKMLIGYIPVHLRISTIEDNPEITFFIHKNYVHL
FYPSESSDEKGSIVTPASLLRWNYRMNPDRILLTEVRGAEAWDFLKITGSGHEGSMTSIHAGSAKEAIDG
FITRCYENPQCAQLPYTFMLRKVLDSLDVIVSIDLDGNVRRMNDIYFRPIHRNQYFEEMKA
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|45476499|ref|NC_005814.1|:12494-13519 Yersinia pestis biovar Microtus str. 91001 plasmid pCRY, complete sequence
ATGACCGCTAAGAATATTTCCCTCGACCGCTATAAACAGCGTTTCTTTGGCGACTTTCTGGAGCTTCCCG
GCCTGACGGAGATCGCCGTCAACCGTCCAGGTGAGCTGTATACCAAAATCAACGGCGTATGGGAGCAGCA
CGCCGTTCCTTTGTCCTATGAGGATTGCTACAACTTTGCCCGGTGCCTGGCAAAGCACCACGGCGACAAT
ATCGAAGATATTAAGCCGGGGCTGTCAGCCACGCTGGAATCTGGCGAACGGTGCCAGGTGATTGTTCCCC
CGGCCTGTGAGCGCGATACGGTGTCTATCACCATCCGTAAGCCATCAAAGGTACAAATCCCGCATCAGTC
GTATATCGATGCGGGATTTTATAACCGGGTAACAGGCGAGGAAAAAACGGAGACGCACGACGAGGAATTA
ATTGCATTGTACAATACAAAAAATATTCCTCTGTTTATGGAGAAATGCGTCGAGTACGGTAAAACTCTCG
CGGTCGCCGGGGAAACAAGTACCGGGAAAACCACCTATATGAAAATGTTGATAGGGTATATTCCTGTACA
TCTTCGGATATCAACCATTGAGGACAACCCGGAAATCACGTTCTTTATCCATAAAAACTACGTCCATCTT
TTTTATCCGTCAGAATCATCAGATGAAAAAGGTTCTATCGTTACCCCAGCGAGCCTTTTACGCTGGAATT
ACCGTATGAACCCTGACCGCATTTTATTAACGGAGGTTCGCGGTGCGGAAGCCTGGGACTTCCTTAAAAT
AACAGGTTCCGGCCATGAAGGGAGTATGACCTCCATTCATGCAGGATCAGCGAAAGAAGCTATAGATGGG
TTTATTACCCGTTGCTATGAAAATCCACAGTGCGCCCAGCTCCCCTATACATTTATGTTACGTAAGGTTC
TGGATAGCCTGGACGTGATTGTGAGCATTGATTTAGACGGAAATGTCCGCCGTATGAATGACATCTATTT
CCGTCCAATTCATCGAAACCAGTATTTTGAGGAAATGAAAGCATGA
 Primer design