SecReT4
Protein ID: 45476521
T4SS name [ID]VirB [410]
Gene symbol-
Locus tagYP_pCRY22
StrainYersinia pestis biovar Microtus str. 91001
Repliconplasmid pCRY [GenBank: NC_005814] [Browse all T4SS(s) in this replicon]
Location [Strand]15359..17110 [+]
Productputative mobilization mobB protein
Component typeVirD4
UniProt IDQ74YS6
KEGG IDypm:YP_pCRY22
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.5e-13, Aligned region: 343..540
TrwB_AAD_bind [PF10412], Evalue: 1.9e-12, Aligned region: 190..231
TrwB_AAD_bind [PF10412], Evalue: 1.9e-12, Aligned region: 351..542
AAA_10 [PF12846], Evalue: 2.3e-09, Aligned region: 195..233
AAA_10 [PF12846], Evalue: 2.3e-09, Aligned region: 381..481
DUF87 [PF01935], Evalue: 9.2e-08, Aligned region: 179..233
TraG-D_C [PF12696], Evalue: 9.4e-08, Aligned region: 404..495
Protein Sequence: 583 a.a.     [Download]
>gi|45476521|ref|NP_995436.1| putative mobilization mobB protein [Yersinia pestis biovar Microtus str. 91001]
MEKIDMGSHLMQRLNAFADAFSFFLLWLQNSPVILSLLAGLTLPFIFHLPREERKNAPFWLKSVACVSIF
FFIFGTISPLTIQGLSYFFKSLDNNILFRVPLWIMTIIFTAAGLIFHIAARRLLAGEIDNLKHRMIKKSK
LERNTRTDVRKVKELLPDSIEYNPLDYIDLKKGVFIGLNKDDQPQYITIKEFKTQHAAIIGTTGSGKGVT
ATVLLYQAILLGEAVFVEDPKDDEWAPHVLREACKKAGKKFTLINLNKLNFQLDLLADISHEQLEELFNA
GFSLAKKGEASDFYRISDRRAARNTSAIYENGMTLRDLFNTDFVQSLREDVPAFCGELEEIALVNSINAK
NGFSLKEVFDEGGCCYIIGSTRNQKIISAQRMILTRLIQIAETRDRINSTPRTVAIFLDELKYHLSRPAL
EGLGTARDKGVHIFMAFQAIDDLRDCPSDLNGDSVIGAIIENAKFKLIYKIQNPETAEWAAKMTGSILVD
DEMRKVRTDLSLTEKVDTDRMIRQAESYYVDSNMFLNLPEKVGFVFTSTELPRATKMFQVQVKKENIELL
SFEYKQATPEKNESQEHKPSINL
 
Nucleotide Sequence: 1752 bp     [Download]
>gi|45476499|ref|NC_005814.1|:15359-17110 Yersinia pestis biovar Microtus str. 91001 plasmid pCRY, complete sequence
ATGGAGAAAATAGATATGGGTTCCCACCTGATGCAAAGGCTGAATGCCTTTGCCGATGCATTTTCCTTTT
TTCTTTTATGGCTGCAAAACAGCCCTGTCATATTATCCCTGCTCGCAGGTCTTACATTACCTTTTATATT
CCACCTTCCCCGTGAGGAAAGAAAGAACGCCCCGTTCTGGTTAAAGTCGGTGGCGTGCGTGTCCATTTTC
TTTTTTATATTCGGCACCATATCACCGCTAACTATTCAGGGGTTGAGCTACTTTTTTAAGTCACTCGACA
ACAACATACTGTTTAGAGTTCCTCTATGGATCATGACCATAATATTTACGGCAGCAGGATTAATATTTCA
TATTGCAGCCCGACGACTTTTAGCAGGAGAAATTGACAACCTAAAACATCGAATGATTAAGAAAAGCAAG
CTGGAGAGAAATACCCGAACCGATGTACGCAAAGTAAAAGAGTTATTGCCCGACAGCATAGAATACAATC
CACTCGATTACATTGATTTAAAGAAAGGTGTTTTTATTGGCTTAAACAAAGATGACCAGCCGCAATACAT
AACCATAAAAGAATTTAAAACCCAACACGCAGCAATTATCGGTACAACAGGTTCCGGGAAAGGCGTAACT
GCAACCGTTCTACTTTATCAGGCTATTCTTTTAGGTGAGGCTGTTTTTGTAGAAGATCCAAAAGATGATG
AATGGGCACCACACGTACTTAGGGAAGCATGTAAAAAAGCAGGCAAGAAATTCACACTTATAAATTTAAA
CAAGCTAAATTTCCAGCTTGATTTACTGGCTGATATCTCTCATGAACAACTGGAGGAATTATTTAACGCT
GGCTTTAGCCTGGCTAAGAAAGGGGAGGCGTCAGATTTTTATCGTATCTCTGACCGTCGCGCAGCCAGAA
ATACATCTGCAATTTATGAAAACGGAATGACGCTTCGTGATTTATTTAACACTGACTTTGTTCAGTCATT
ACGTGAAGATGTTCCCGCATTTTGTGGCGAGCTGGAAGAAATTGCTTTAGTTAACTCAATTAATGCCAAA
AATGGATTTTCATTAAAAGAGGTTTTTGATGAAGGTGGTTGTTGCTACATTATTGGTTCAACGCGAAATC
AAAAGATAATTTCCGCACAAAGAATGATTCTGACCCGGCTGATACAAATAGCGGAGACCAGGGACAGAAT
AAACAGTACCCCGCGTACTGTTGCTATTTTCCTCGACGAGTTGAAATATCATCTTTCTCGCCCTGCTCTT
GAAGGACTTGGAACGGCACGAGATAAAGGCGTGCATATATTCATGGCTTTTCAGGCGATAGACGATCTGC
GTGACTGCCCGTCTGATTTAAATGGTGATTCAGTTATTGGCGCTATCATTGAAAACGCCAAATTCAAATT
AATTTATAAAATCCAGAATCCCGAAACAGCAGAATGGGCGGCCAAAATGACAGGCTCTATCCTGGTCGAT
GATGAAATGAGAAAAGTACGGACTGATTTATCATTAACGGAAAAAGTGGATACAGACCGAATGATAAGAC
AGGCAGAAAGTTACTACGTTGACAGTAATATGTTTTTAAATCTCCCTGAAAAAGTTGGTTTTGTATTTAC
GTCAACCGAACTACCAAGAGCTACAAAGATGTTTCAGGTTCAGGTCAAAAAAGAAAACATCGAACTTCTT
TCATTTGAGTATAAACAAGCCACACCAGAAAAAAATGAAAGTCAGGAACATAAGCCATCAATCAATCTGT
GA
 Primer design