SecReT4
Protein ID: 46447056
T4SS name [ID]Tra_F [551]
Gene symbol-
Locus tagpc1422
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1697757..1698062 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ6MBA3
KEGG IDpcu:pc1422
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.3e-12, Aligned region: 11..99
Protein Sequence: 101 a.a.     [Download]
>gi|46447056|ref|YP_008421.1| hypothetical protein pc1422 [Candidatus Protochlamydia amoebophila UWE25]
MAQESPRMTCKTFDQSIRILFWSLDEFLILIPLSFVGIFLRSLVLLGLAILLKTLYIQMKKKSRHQPLSH
YLYQYFPTSFCQKLGYFEGLPPSHLKKVILT
 
Nucleotide Sequence: 306 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1697757-1698062 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
ATGGCACAAGAAAGCCCTAGAATGACATGTAAAACTTTTGATCAATCTATTCGCATTCTGTTTTGGTCAT
TGGATGAATTTTTGATCTTAATCCCCCTAAGCTTTGTTGGCATTTTCCTTCGAAGCTTAGTGTTATTAGG
ATTGGCAATCCTTTTAAAGACGCTATATATACAAATGAAAAAAAAGAGCCGGCACCAACCCTTGAGTCAC
TACCTCTACCAATATTTTCCAACATCTTTTTGTCAAAAATTAGGCTATTTTGAAGGACTCCCCCCTTCAC
ACCTTAAAAAAGTCATTTTAACGTAA
 Primer design