SecReT4
Protein ID: 46447057
T4SS name [ID]Tra_F [551]
Gene symboltraE
Locus tagpc1423
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1698071..1698640 [+]
ProductF pilus assembly protein traE
Component typeTraE_F
UniProt IDQ6MBA2
KEGG IDpcu:pc1423
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 4.9e-28, Aligned region: 6..180
Protein Sequence: 189 a.a.     [Download]
>gi|46447057|ref|YP_008422.1| F pilus assembly protein traE [Candidatus Protochlamydia amoebophila UWE25]
MERIFFERNLNHLLVQRNFLVGLSLTLLMGVILAVSFLCFKTERIIIVPSTIEKEFWVDAHSVSATYLEQ
FGLFLGQLLLTKSSYSADLHRNILCRHTEPQYLALLKQRLMEEEETLKKQNASYVFYLNNVHVNPKELTV
TLLGDRQFFLAGQQTTLESCGYTLHFNYSGARLLLKGITQEKTDLARRA
 
Nucleotide Sequence: 570 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1698071-1698640 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
ATGGAACGGATTTTTTTTGAACGCAATCTCAATCATTTATTAGTGCAGAGAAACTTTTTAGTGGGATTGT
CGTTAACCTTACTGATGGGAGTGATCTTAGCTGTCTCCTTCCTTTGCTTCAAAACAGAAAGAATTATTAT
TGTCCCTTCAACGATTGAAAAAGAATTTTGGGTTGATGCTCATTCCGTTTCAGCCACCTATCTCGAACAA
TTTGGATTGTTTTTAGGGCAACTCTTGCTCACCAAATCTTCTTATTCTGCAGATTTACACCGCAATATTT
TGTGTCGACATACCGAGCCTCAGTATCTTGCTTTATTAAAACAAAGATTAATGGAAGAAGAGGAGACTTT
AAAGAAACAAAACGCTTCTTACGTTTTTTACTTAAATAATGTTCACGTCAATCCCAAAGAATTAACGGTG
ACTTTGCTCGGAGATCGGCAATTTTTCCTTGCAGGTCAGCAAACCACCTTGGAAAGCTGCGGCTATACCT
TGCATTTCAATTACAGCGGAGCTCGCCTTCTTCTAAAGGGGATCACTCAAGAAAAAACCGACCTTGCGAG
GAGAGCCTAG
 Primer design