SecReT4
Protein ID: 46447058
T4SS name [ID]Tra_F [551]
Gene symbol-
Locus tagpc1424
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1698641..1699333 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDQ6MBA1
KEGG IDpcu:pc1424
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 6.2e-45, Aligned region: 1..222
Protein Sequence: 230 a.a.     [Download]
>gi|46447058|ref|YP_008423.1| hypothetical protein pc1424 [Candidatus Protochlamydia amoebophila UWE25]
MKQIFWMGFACLQVLKLSAATYHTLNTTSLLPCYLSSTYQNRVMIENGRIKKVITPESDRLSIQIEELTG
QAFIFARDPHLKEISLSVISDSGVIQDIHICFIERQPEVVVLQEPEQKECSPGVPAAEELSILKQVQEIV
AGRIPTGYRHKSISSQKRTLKKGIELTLKAKFIGSENTLYLYQLANTGKQPQTVLECEMGSQQSQWIYLE
QNMIAPKQTKVCILAVKNHA
 
Nucleotide Sequence: 693 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1698641-1699333 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
ATGAAACAAATTTTTTGGATGGGCTTTGCCTGTCTGCAAGTTTTAAAACTTTCGGCTGCCACCTATCACA
CGCTCAATACAACAAGCCTTTTGCCCTGCTACTTATCTTCTACTTATCAAAATCGGGTGATGATTGAAAA
TGGACGAATTAAAAAAGTGATTACCCCAGAATCTGATCGTCTTTCCATTCAAATTGAAGAGTTAACAGGC
CAAGCATTTATTTTTGCCCGGGATCCTCATCTGAAAGAGATCTCTCTTTCGGTCATCTCCGATTCGGGTG
TCATTCAAGATATCCATATTTGTTTTATAGAGCGTCAGCCTGAAGTTGTTGTCTTGCAGGAACCAGAACA
GAAAGAGTGTTCACCTGGCGTGCCTGCTGCCGAGGAGCTCTCCATTTTGAAACAAGTTCAAGAGATTGTT
GCTGGGAGAATTCCTACCGGTTATCGACACAAATCTATCTCTTCGCAAAAACGCACTCTAAAAAAAGGAA
TCGAGCTTACGCTTAAAGCTAAATTTATCGGATCAGAAAATACTCTTTACCTCTATCAGCTAGCTAATAC
GGGCAAACAACCTCAAACAGTTTTAGAATGTGAGATGGGAAGTCAGCAAAGTCAATGGATCTATTTAGAA
CAAAACATGATCGCTCCCAAGCAAACAAAGGTTTGTATTCTTGCGGTGAAAAACCATGCCTGA
 Primer design