SecReT4
Protein ID: 46447059
T4SS name [ID]Tra_F [551]
Gene symboltraB
Locus tagpc1425
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1699404..1700630 [+]
ProductF pilus assembly protein traB
Component typeTraB_F
UniProt IDQ6MBA0
KEGG IDpcu:pc1425
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.9e-31, Aligned region: 193..387
Protein Sequence: 408 a.a.     [Download]
>gi|46447059|ref|YP_008424.1| F pilus assembly protein traB [Candidatus Protochlamydia amoebophila UWE25]
MFGLIKYAYDHYEPTSYDLFEPRIDLPVDEFQSKEVWMDRLETQVGFLIQKQKYYEETLLEYKERERANE
KEKIELKQYLTLLKKKMEASQVREEELKNKKDTSALEIASSSKNTFDRPVFEQAEESLLPPSSYRFPSSS
FSSDPFVSQGTIASFGQEAVKATETAALRPPLCEYTLPQEAKNELFSLEKRTPANVSVRAILLSSVDAVC
RLDAQSDPIPVKLRLLDDAHLPGGMKVKLKGCLIGASAYGDISSERVYMRLENLTQVNLSGQAIETEVTG
YVSGEDGRFGMRGILVDRSAKILKPALGSGILSGIAQTLQSACARPSKETINTYSLSSDFAQNTVAKTSD
AFSLLASYYIKRAEQVQPVLQIDAGRLVDVTFTQGFSMGDLHAKENLKQIRNKHRPSS
 
Nucleotide Sequence: 1227 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1699404-1700630 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
GTGTTTGGTTTGATCAAATATGCATATGATCATTATGAACCCACTTCTTATGACTTATTTGAACCAAGGA
TCGATTTACCTGTGGATGAATTTCAATCCAAAGAAGTGTGGATGGATCGTTTGGAAACGCAAGTGGGCTT
CTTGATCCAAAAGCAAAAGTACTATGAAGAGACGTTACTTGAGTATAAAGAAAGAGAAAGAGCGAACGAA
AAAGAGAAAATCGAACTCAAGCAGTATTTGACTCTTTTGAAAAAGAAAATGGAAGCATCCCAAGTTAGAG
AAGAGGAGTTAAAGAATAAAAAGGATACCTCAGCTCTAGAAATAGCCTCTTCAAGCAAAAACACATTTGA
CCGCCCCGTGTTTGAGCAAGCAGAGGAAAGCTTGCTTCCACCTTCTTCTTATCGATTTCCTTCTTCCTCT
TTTTCTAGTGATCCGTTTGTCTCCCAAGGAACAATAGCCTCTTTCGGACAGGAGGCTGTCAAAGCGACTG
AGACAGCTGCTTTAAGACCGCCTCTTTGTGAATATACGCTGCCTCAGGAAGCAAAAAATGAACTTTTTTC
CCTTGAAAAAAGAACGCCTGCCAATGTAAGTGTGCGTGCCATTCTCCTTTCTAGTGTGGATGCTGTTTGT
AGACTAGACGCTCAAAGCGATCCTATCCCTGTAAAATTACGCCTCTTAGATGATGCTCATTTACCCGGAG
GAATGAAAGTAAAGTTGAAAGGATGTCTGATTGGAGCGAGCGCTTACGGAGATATTTCCAGTGAACGTGT
CTATATGCGATTAGAAAACTTAACGCAAGTCAATCTCAGCGGGCAAGCCATTGAAACGGAAGTGACCGGT
TATGTGTCAGGAGAAGATGGAAGATTTGGAATGCGAGGGATCTTGGTGGATCGCTCCGCTAAAATATTAA
AACCAGCCCTTGGCAGTGGGATCTTATCTGGAATTGCTCAAACGCTTCAGTCGGCATGCGCTCGCCCATC
CAAAGAAACGATTAATACCTACTCGCTCAGCTCGGATTTTGCTCAAAATACGGTGGCTAAAACTTCAGAT
GCCTTTAGCCTTTTGGCTTCTTACTATATTAAACGAGCAGAACAAGTCCAACCTGTCCTTCAAATTGATG
CAGGTCGCTTAGTCGATGTCACGTTTACGCAAGGATTTAGCATGGGAGATCTCCATGCTAAGGAAAATTT
AAAACAGATTCGCAATAAACACAGGCCTTCCTCATGA
 Primer design