SecReT4
Protein ID: 46447064
T4SS name [ID]Tra_F [551]
Gene symboltraC
Locus tagpc1430
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1702800..1705286 [+]
Productinner-membrane protein traC
Component typeTraC_F
UniProt IDQ6MB95
KEGG IDpcu:pc1430
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.4e-53, Aligned region: 462..743
TraC_F_IV [PF11130], Evalue: 3.7e-39, Aligned region: 40..262
Protein Sequence: 828 a.a.     [Download]
>gi|46447064|ref|YP_008429.1| inner-membrane protein traC [Candidatus Protochlamydia amoebophila UWE25]
MRSFLQKLGNIVAGLFGESPFSFSSDTAQALPSDPYPSATPLSAYLSYDVYDEDNELFINKKSLGFAIEM
LPLVGSDHAAQKNIQSLFDEVLEEGESIQCLLWTDHRIDPFLNFWEEPRKQKGGIFAKIAHQRVKTFRHH
KQFFPSLFRFVLSYTVPFKGDLQTNAPLIQKMKAKKEKCLRILRALSRSARVWKPIDLMDVVGGMCQFSF
STEAVTPLWNPYQSLASQIPRGTSLEIQEGQLKANRPSPLAFKSFRVVDFPEFWSLSQMQHLIGDVERDS
FRLLCPFYLHWAVHCPSQQLAEQKFKVREKFVEKQGQSSMFLKMVPQLADELKEIQYARKEIYQGARYVW
TNLSVGIWSSPDNLVHSEEILKGIFRNNRFTLVENQAFPLAAFLSALPLSLAESVKGLKNLNFFRTTLNR
ECGNYVPLQGEWYGTLKSSGILLAGRRGQLMNWNPFDNDHGNYNITVVGRSGSGKSVFMQELIFNGLGTG
AKVFVLDVGRSFDKLCQALEGQMIEFSRQSTICLNPFTKFPLNNVNELNDCIILLKSIIANMADSINGMS
SEQMSLIEESIKEVWKLKGCEASLTDVANWLKQHEDVQARKIGRMLFPYTIDGVFGHYFEGKNNVDFTNP
FVLIELEELKEKKELQAVVLQLLILTITDQAFLGDRKTRFYICVDEAWDLLRANQTGPFIETLARRLRKY
NGSLIVGTQQLEDFDSYPGAKAAYANSDWACFLPQDDKTIATLKAESKMPEGKIQAIENLNTLHGVYSEV
LICQGKSYSTHRFWLDSFSNLLYSTQAADFSRLQKLREQGKSLEEAIEELVQEKACHS
 
Nucleotide Sequence: 2487 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1702800-1705286 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
ATGCGATCATTTTTGCAAAAATTGGGGAATATCGTGGCAGGTTTATTCGGAGAATCCCCTTTTTCATTTT
CGTCAGACACAGCGCAGGCTTTACCGAGCGATCCCTATCCATCAGCTACCCCTCTTTCTGCCTATCTATC
TTATGATGTATATGATGAAGACAATGAATTATTCATCAATAAAAAAAGTTTAGGGTTTGCCATTGAAATG
CTTCCTTTGGTTGGAAGTGATCATGCAGCTCAAAAGAATATTCAAAGTCTTTTTGATGAGGTGTTAGAAG
AAGGAGAGTCGATTCAGTGCCTTCTTTGGACCGATCACCGCATTGATCCTTTCCTCAATTTCTGGGAGGA
GCCTAGAAAACAAAAAGGGGGAATTTTTGCCAAGATTGCTCACCAACGGGTCAAGACTTTTCGCCATCAC
AAACAGTTTTTTCCCTCTCTTTTTCGCTTTGTACTCTCCTACACTGTCCCATTTAAAGGAGATCTTCAAA
CAAATGCCCCCTTAATTCAAAAAATGAAGGCCAAAAAAGAGAAGTGTTTAAGAATTTTACGTGCTCTTTC
TCGCTCGGCTCGGGTTTGGAAACCGATCGATTTAATGGATGTCGTTGGGGGCATGTGCCAATTTTCTTTC
AGTACAGAAGCGGTCACTCCCCTTTGGAACCCCTACCAATCCCTGGCAAGTCAGATTCCAAGAGGAACTA
GTTTAGAAATTCAAGAGGGGCAGTTAAAGGCTAATCGTCCCTCCCCTCTGGCGTTCAAAAGTTTTCGAGT
AGTGGATTTTCCTGAATTTTGGTCACTCAGCCAGATGCAACATCTGATTGGAGATGTCGAAAGAGATAGC
TTCCGTTTACTTTGTCCGTTTTATCTTCACTGGGCAGTGCATTGTCCAAGTCAACAGTTAGCGGAACAAA
AATTTAAAGTGCGTGAGAAATTTGTCGAAAAACAGGGGCAATCCTCTATGTTTTTAAAAATGGTTCCTCA
ACTGGCAGATGAACTGAAAGAAATCCAATATGCTCGAAAAGAGATATATCAAGGGGCTCGCTATGTCTGG
ACCAACTTGTCTGTTGGCATTTGGAGCTCTCCTGACAATTTGGTTCATTCAGAAGAAATCCTAAAAGGAA
TTTTTCGAAATAATCGCTTCACGTTAGTGGAAAATCAAGCGTTTCCTTTGGCAGCTTTTTTATCGGCATT
ACCATTAAGTTTGGCAGAGTCTGTTAAAGGACTCAAAAATCTCAATTTTTTTCGAACCACTCTCAATCGA
GAGTGTGGTAACTACGTTCCTTTGCAAGGAGAATGGTATGGCACCCTCAAAAGTTCCGGGATTCTATTAG
CTGGTCGAAGAGGGCAGCTCATGAATTGGAATCCTTTTGATAATGACCATGGGAATTACAACATCACAGT
CGTTGGAAGAAGTGGATCGGGAAAGTCTGTCTTTATGCAAGAACTGATTTTTAACGGATTAGGAACAGGA
GCCAAGGTCTTTGTTTTGGATGTGGGAAGAAGCTTTGACAAACTTTGCCAAGCGTTAGAAGGACAAATGA
TTGAGTTTTCAAGACAATCTACCATTTGTTTAAACCCCTTCACCAAATTTCCTCTGAATAACGTTAATGA
ACTCAATGACTGCATTATTCTCCTTAAATCGATCATCGCCAACATGGCAGATTCCATCAATGGGATGAGT
AGTGAACAAATGAGTTTAATCGAAGAATCTATCAAAGAAGTGTGGAAACTTAAAGGTTGTGAAGCCTCTC
TAACAGATGTTGCCAACTGGTTAAAACAACACGAAGATGTCCAGGCTCGCAAGATCGGTAGAATGCTATT
TCCCTATACCATCGATGGCGTTTTTGGACACTATTTTGAAGGAAAAAATAATGTCGATTTTACCAATCCT
TTTGTCTTGATTGAGTTAGAAGAACTGAAAGAAAAAAAAGAGCTACAAGCTGTGGTGCTTCAATTATTGA
TTTTAACGATTACGGATCAAGCGTTTTTAGGAGATCGTAAAACGCGCTTTTATATTTGTGTAGATGAGGC
TTGGGATCTTTTAAGAGCGAATCAGACAGGGCCCTTTATTGAAACCTTGGCAAGACGTCTGCGTAAATAC
AATGGATCATTAATTGTTGGAACGCAACAATTAGAAGATTTTGACAGCTATCCTGGCGCCAAGGCTGCTT
ACGCCAATAGTGATTGGGCTTGTTTTCTTCCTCAAGACGATAAAACGATTGCCACTCTTAAGGCAGAATC
AAAAATGCCTGAGGGAAAAATTCAAGCAATTGAAAACTTAAATACCTTGCATGGCGTTTATAGTGAAGTT
TTGATTTGTCAAGGAAAGTCCTATTCGACGCATCGCTTCTGGTTAGATTCCTTTTCTAATTTGCTTTATA
GCACCCAGGCGGCTGACTTTTCTCGTTTGCAAAAGCTACGCGAGCAAGGGAAAAGCTTGGAAGAGGCCAT
TGAAGAGCTCGTGCAGGAGAAAGCATGTCACTCTTAA
 Primer design