SecReT4
Protein ID: 46447066
T4SS name [ID]Tra_F [551]
Gene symboltraW
Locus tagpc1432
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1705741..1706373 [+]
ProductF pilus assembly protein traW
Component typeTraW_F
UniProt IDQ6MB93
KEGG IDpcu:pc1432
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 210 a.a.     [Download]
>gi|46447066|ref|YP_008431.1| F pilus assembly protein traW [Candidatus Protochlamydia amoebophila UWE25]
MPPFLTGILTVLLIFSSLEAKNLGIYGATASIEEEDLLIFMQKNMQLITEADHEKWMQNLQSHLLAQMKK
PFVIKGIGKTQTYTVSYFDPSITVDRDILNHSQQIVVKKGTRINPLSLVMLDQDLLFVDATDTEQLAWAQ
ALYPSGKWILVKGQPMQLEEELQRPIYFDQGGVLLKKFGIQSVPARVSQEGLRLKIELIPIGESSCVPIS
 
Nucleotide Sequence: 633 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1705741-1706373 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
ATGCCCCCTTTTCTAACAGGAATCTTGACAGTTTTGCTTATCTTTTCTTCATTAGAAGCCAAAAATTTAG
GAATTTATGGAGCAACTGCTTCAATTGAGGAAGAAGATCTCCTCATTTTCATGCAAAAAAATATGCAATT
GATCACGGAAGCTGACCATGAAAAGTGGATGCAAAATTTACAGAGTCATTTGCTTGCTCAGATGAAAAAA
CCTTTTGTCATCAAGGGAATTGGAAAAACCCAAACGTACACGGTGAGCTATTTTGATCCGAGCATTACGG
TAGATCGAGATATCCTCAATCATTCTCAGCAAATCGTGGTGAAAAAAGGAACGCGGATCAATCCTCTGTC
TTTAGTAATGCTGGATCAAGATTTATTATTCGTTGATGCCACAGATACAGAGCAATTGGCTTGGGCGCAG
GCACTTTATCCTTCTGGAAAGTGGATTCTGGTTAAAGGACAACCCATGCAACTCGAAGAAGAGCTCCAAC
GTCCCATCTATTTTGACCAAGGAGGAGTCCTTCTTAAAAAATTTGGCATCCAAAGTGTTCCAGCACGCGT
CTCCCAAGAAGGGTTGCGACTCAAAATAGAATTAATTCCGATTGGAGAGAGTTCATGCGTGCCTATTTCT
TAA
 Primer design