SecReT4
Protein ID: 46447067
T4SS name [ID]Tra_F [551]
Gene symboltrbC
Locus tagpc1433
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1706382..1706978 [+]
ProductF pilus assembly protein trbC
Component typeTrbC_F
UniProt IDQ6MB92
KEGG IDpcu:pc1433
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 6.7e-25, Aligned region: 80..178
Protein Sequence: 198 a.a.     [Download]
>gi|46447067|ref|YP_008432.1| F pilus assembly protein trbC [Candidatus Protochlamydia amoebophila UWE25]
MLLNGGLWGEEMQHFALDSNWLKQAQQVDEKAVHWLKDHLKERLASENFLRNPLEEKGSQLATTQCQSAG
MEVKEESPLYVFMSFSLDDRLWVQLSQELEKLGGIFVLRGLPQNSFKELANRIFTLQEQGVRVPIQIHPQ
LFQRFDIQLVPTIAVTEGEQYDKISGNLSIQGALEKMSLYGETQRAKFLLQQWKEQQK
 
Nucleotide Sequence: 597 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1706382-1706978 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
TTGTTGCTGAATGGAGGACTATGGGGAGAAGAAATGCAACATTTTGCTTTAGACTCCAATTGGCTTAAGC
AAGCGCAACAAGTCGATGAAAAAGCTGTGCATTGGCTAAAAGACCATTTAAAAGAGCGTTTGGCATCGGA
GAATTTTTTGAGAAATCCCCTAGAGGAAAAGGGATCGCAACTCGCCACTACTCAATGCCAAAGTGCGGGA
ATGGAGGTTAAAGAAGAGTCTCCTCTCTATGTATTTATGTCCTTTTCATTAGACGATCGCTTGTGGGTGC
AATTGTCCCAAGAGTTAGAGAAACTAGGAGGAATTTTTGTGTTAAGAGGGCTTCCGCAAAATAGCTTTAA
AGAATTGGCCAACCGAATCTTTACGTTGCAAGAACAAGGCGTGCGTGTGCCTATCCAAATTCACCCTCAG
CTATTTCAAAGATTTGACATTCAACTAGTGCCAACCATTGCTGTTACCGAGGGTGAGCAGTATGACAAAA
TCTCGGGAAATCTTTCTATACAGGGTGCTTTAGAAAAAATGTCCCTGTACGGAGAGACTCAGCGAGCCAA
ATTCCTTTTGCAACAATGGAAAGAGCAACAAAAATGA
 Primer design