SecReT4
Protein ID: 46447068
T4SS name [ID]Tra_F [551]
Gene symboltraU
Locus tagpc1434
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1707047..1707982 [+]
ProductF pilus assembly protein traU
Component typeTraU_F
UniProt IDQ6MB91
KEGG IDpcu:pc1434
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.1e-64, Aligned region: 1..295
Protein Sequence: 311 a.a.     [Download]
>gi|46447068|ref|YP_008433.1| F pilus assembly protein traU [Candidatus Protochlamydia amoebophila UWE25]
MNPFTDVCWECVFPLTVSGVSVTPGHPDLSKSNKRICTCAGVPPRVGIPLTFWEPLNLVDVTRHAYRLVG
LGGVSVGSDSIKNRGTVSVLGDGPAQTSVYHVHWYHFPLLSLLNLLTDFICVEQGDVDLPYLSELDPLWN
DDTLALIVNPEAALFNSPLAQVSCIADCSMASLNHPIDELFWCAGCEGSLYPLTGVVAHHLSPIQASYLL
VQRLIAKLHRMFLLKGYDKGEFCEAQMMPILKKTLYKTHLIYPIPQTSGLCHALGKSDLLWGIGKSFPIQ
GEDFVYLIWSKKHCCLDSTKAAAMKPIGGLW
 
Nucleotide Sequence: 936 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1707047-1707982 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
ATGAATCCGTTTACCGATGTGTGTTGGGAATGTGTTTTTCCTTTGACCGTGAGCGGAGTGTCGGTAACTC
CTGGCCATCCGGATCTTTCCAAGTCAAACAAACGTATCTGTACTTGCGCGGGAGTTCCTCCTCGCGTTGG
CATTCCTTTGACATTCTGGGAGCCACTGAATCTAGTTGATGTCACCCGGCACGCCTATCGCCTGGTTGGA
TTGGGAGGCGTTTCAGTGGGAAGTGATTCGATAAAAAATCGTGGGACTGTGTCGGTTTTGGGTGATGGGC
CTGCCCAAACAAGCGTTTATCATGTGCATTGGTATCATTTTCCTCTCTTGAGCTTGCTCAACCTTTTGAC
CGATTTCATTTGTGTCGAACAAGGAGATGTTGACCTACCCTATTTGAGTGAATTAGATCCTTTATGGAAT
GATGACACGTTAGCTTTGATTGTGAATCCAGAGGCGGCCCTATTTAACTCTCCTTTAGCACAAGTTTCTT
GTATTGCGGACTGCTCAATGGCAAGTCTTAATCACCCGATCGATGAGTTATTTTGGTGCGCTGGCTGTGA
AGGATCACTATACCCGTTAACGGGAGTTGTTGCCCACCATCTAAGTCCCATCCAAGCTAGTTATCTCCTT
GTTCAACGTTTAATTGCCAAACTACACCGCATGTTTCTCTTAAAAGGATACGATAAAGGAGAGTTTTGTG
AAGCACAAATGATGCCTATCTTGAAGAAAACGCTTTATAAAACGCACCTGATTTATCCAATTCCTCAAAC
TTCTGGACTTTGTCATGCTTTGGGAAAAAGTGATCTGTTATGGGGAATTGGCAAATCTTTTCCCATTCAG
GGAGAAGATTTTGTCTATTTGATTTGGTCTAAAAAACATTGTTGTCTCGATTCAACAAAAGCAGCGGCCA
TGAAGCCCATCGGAGGTTTATGGTAA
 Primer design