SecReT4
Protein ID: 46447071
T4SS name [ID]Tra_F [551]
Gene symboltraN
Locus tagpc1437
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1709083..1709637 [+]
Productconjugative transfer protein traN
Component typeTraN_F
UniProt IDQ6MB88
KEGG IDpcu:pc1437
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 6.8e-29, Aligned region: 8..133
Protein Sequence: 184 a.a.     [Download]
>gi|46447071|ref|YP_008436.1| conjugative transfer protein traN [Candidatus Protochlamydia amoebophila UWE25]
MAVFAEVKKEMENSQAMDATKLEIFQGKRMSCSKNVADHLLYDCCFRYSGLAKQMGLSKCNADELSLAEM
REEGLCHYVGSYEEKILDLWKSRDEHVFCCFPSKLSRLVQEQGRKQLGRDWGKPEEPNCRGFTTQELSRL
NFSDMDLSEICTNIAKKLPENLPERLKQFQNRLQKDMDRVEVKK
 
Nucleotide Sequence: 555 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1709083-1709637 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
TTGGCCGTGTTTGCAGAGGTAAAAAAAGAAATGGAAAATTCTCAAGCCATGGACGCGACAAAATTAGAAA
TTTTCCAGGGCAAACGCATGTCCTGTAGCAAAAATGTGGCTGATCACCTCCTATATGACTGCTGTTTTCG
CTATTCTGGCTTGGCAAAACAAATGGGTTTAAGTAAGTGCAATGCGGATGAACTTTCCTTAGCCGAGATG
CGAGAAGAGGGGCTTTGTCATTACGTCGGATCCTATGAAGAAAAAATTTTGGATTTATGGAAAAGCCGCG
ATGAGCATGTCTTTTGCTGTTTTCCCTCTAAATTATCTCGTCTTGTGCAAGAACAGGGAAGAAAACAATT
GGGCAGAGATTGGGGAAAGCCTGAAGAGCCCAATTGTCGAGGATTCACGACCCAAGAATTAAGCCGGTTG
AATTTTTCAGACATGGATTTAAGTGAAATCTGCACAAATATCGCCAAAAAATTGCCAGAGAATCTTCCCG
AACGTCTCAAGCAATTTCAAAATCGCCTACAGAAAGATATGGACCGAGTCGAGGTGAAGAAATGA
 Primer design