SecReT4
Protein ID: 46447072
T4SS name [ID]Tra_F [551]
Gene symboltraF
Locus tagpc1438
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1709634..1710425 [+]
ProductF pilus assembly protein traF
Component typeTraF_F
UniProt IDQ6MB87
KEGG IDpcu:pc1438
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.8e-70, Aligned region: 32..252
Protein Sequence: 263 a.a.     [Download]
>gi|46447072|ref|YP_008437.1| F pilus assembly protein traF [Candidatus Protochlamydia amoebophila UWE25]
MSFKNNFVRLSLFSLLIGQDLSGGWLNRKAEGWFWYEERQKQIEEEDIKPSPLLPSMEPPPPLTATEQMG
LKRQEIEEKLNQAMLNPSEENVQAYMQIQQQWINQSAQFSHIWLKNLLTYPQLDSRLTAGPVTHYGAQVQ
KQLLREEREGRIHSLVQSFGLFFFYEGSSPISQAFSFVVKAFAKKYDWKVIAISCDGIQIPDFENYPLHS
STLQHLGIEQFPSLYLVEPKQQKMVPIAFGLSSLDQIEENIILQLPPHPRNHP
 
Nucleotide Sequence: 792 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1709634-1710425 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
ATGAGTTTCAAAAATAACTTTGTCCGTTTAAGTCTTTTTTCTCTTTTGATAGGACAGGATTTGTCAGGAG
GGTGGCTGAATCGAAAGGCGGAAGGATGGTTTTGGTACGAAGAGCGACAAAAGCAAATAGAGGAAGAAGA
TATCAAGCCTTCACCCCTTTTACCCTCTATGGAACCTCCTCCTCCGTTAACCGCTACGGAACAAATGGGA
TTGAAGCGTCAAGAAATTGAAGAGAAGTTAAACCAAGCCATGTTAAACCCCTCAGAAGAAAATGTACAAG
CCTATATGCAAATTCAACAGCAATGGATCAATCAATCGGCTCAATTTTCTCATATCTGGTTAAAAAATTT
ATTGACGTACCCTCAATTGGATTCTCGTTTAACGGCAGGACCTGTGACCCACTATGGGGCTCAAGTACAA
AAACAACTTTTAAGGGAAGAGCGGGAGGGACGCATTCATTCTCTTGTACAGTCGTTTGGCCTTTTCTTTT
TTTATGAAGGCAGCAGTCCAATTTCTCAGGCCTTTTCCTTTGTCGTCAAAGCATTTGCCAAAAAATACGA
TTGGAAAGTAATTGCCATTTCCTGTGATGGGATCCAAATTCCCGATTTTGAAAACTATCCGCTGCATTCA
AGCACTCTTCAACATTTAGGTATTGAACAATTCCCCTCGCTCTATTTAGTTGAACCTAAACAACAAAAAA
TGGTGCCTATTGCTTTTGGTCTCTCCTCCCTTGATCAAATTGAAGAAAATATTATTCTACAATTGCCCCC
TCATCCTAGGAATCATCCATGA
 Primer design