SecReT4
Protein ID: 46447073
T4SS name [ID]Tra_F [551]
Gene symboltraH
Locus tagpc1439
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1710422..1711780 [+]
ProductF pilus assembly protein traH
Component typeTraH_F
UniProt IDQ6MB86
KEGG IDpcu:pc1439
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 9.7e-105, Aligned region: 24..381
Protein Sequence: 452 a.a.     [Download]
>gi|46447073|ref|YP_008438.1| F pilus assembly protein traH [Candidatus Protochlamydia amoebophila UWE25]
MKPLLFFILLSFSLTLRADLHNDLKSYLSELNTYSHVDKNEIYHSQRAGYMTGGGISIRNGASHTALAQV
SLPKFDAGCGGIDIFTGGISFISHDQLIAALKNIASSAQGYAFMLGIETVSPLIASTMKQMETWANAINS
LGINSCEVATGLVGSVWPARTAAKQQICRSAKNGGFASSFINARHQCADEGDYAKTMQSMAKDPLYDGML
LEEYNLTWKAVQKHPFLAKKENRKMAEEIMSLTGTLIIRRDKSLVVEPWPSRIYDDSFLPILLEGGTTRV
YQCTGGNAKQNCLALEMKELTIPAEQAWKGRIKQALATIQQKILADTPLASEEIDLLSKSRLPLFKIVNV
LTAYKREVSPISLYEVAEIVGNEMLIQYLREIIGTVRLAAIQLERGQMYDFDSQKFIEELERVEKVVSRY
EERHYQRLEAENQLMLKIETLEQKIASQIILF
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1710422-1711780 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
ATGAAACCTCTTCTTTTTTTTATCCTCCTTTCCTTCTCTTTAACTTTAAGAGCTGATTTGCATAACGATC
TCAAAAGTTATTTGAGTGAGCTCAATACCTATTCACACGTCGATAAAAATGAAATTTACCATTCGCAACG
AGCAGGTTACATGACAGGAGGAGGCATCAGCATACGAAATGGAGCTTCTCATACCGCCTTGGCTCAGGTC
AGTCTACCTAAATTTGATGCTGGTTGCGGAGGGATTGATATTTTCACGGGCGGGATCAGTTTTATTAGTC
ATGATCAATTGATTGCTGCCCTCAAAAATATTGCGAGCTCTGCGCAAGGGTATGCGTTTATGTTGGGGAT
TGAGACTGTCTCTCCCCTGATTGCTAGCACGATGAAACAAATGGAAACGTGGGCCAATGCGATTAATTCC
TTGGGAATCAATAGCTGCGAAGTCGCAACGGGCCTTGTAGGATCGGTTTGGCCTGCACGAACTGCAGCTA
AGCAGCAAATTTGTCGTTCAGCAAAAAATGGGGGCTTTGCCTCTAGTTTTATTAACGCTCGTCACCAATG
TGCGGATGAAGGAGACTATGCCAAGACGATGCAATCGATGGCTAAAGATCCTCTATACGATGGGATGTTG
TTAGAAGAGTATAATCTAACCTGGAAAGCCGTTCAAAAACACCCTTTTCTTGCCAAAAAAGAAAATCGAA
AAATGGCTGAGGAAATCATGAGTTTGACAGGAACCTTGATCATTCGAAGAGATAAATCCCTTGTCGTTGA
ACCTTGGCCCTCCCGTATTTACGATGATTCCTTTTTACCCATTCTTTTAGAGGGAGGGACAACACGGGTG
TATCAATGCACGGGTGGCAACGCTAAACAAAACTGCCTTGCTTTGGAGATGAAAGAGTTGACGATTCCGG
CTGAACAAGCGTGGAAGGGGCGAATTAAACAGGCCTTAGCGACCATTCAACAAAAAATTTTAGCAGATAC
TCCCCTGGCAAGCGAAGAAATTGATCTTTTATCGAAATCACGGCTTCCCCTTTTTAAGATTGTTAATGTT
TTAACCGCCTATAAACGAGAAGTTAGCCCCATCAGTTTATACGAGGTTGCGGAAATTGTCGGTAATGAAA
TGCTCATTCAATACTTAAGAGAAATCATTGGAACGGTTCGTTTAGCTGCTATTCAGCTTGAACGCGGGCA
AATGTATGATTTTGATAGTCAAAAGTTTATTGAGGAGTTAGAGCGTGTAGAAAAAGTTGTTTCCCGCTAT
GAGGAACGTCATTATCAACGCTTAGAAGCGGAAAATCAGCTTATGCTCAAAATAGAGACACTGGAACAAA
AAATTGCTTCGCAGATTATTCTTTTTTAG
 Primer design