SecReT4
Protein ID: 46447074
T4SS name [ID]Tra_F [551]
Gene symboltraG
Locus tagpc1440
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1711791..1714574 [+]
Productconjugative transfer protein traG
Component typeTraG_F
UniProt IDQ6MB85
KEGG IDpcu:pc1440
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.4e-103, Aligned region: 11..452
Protein Sequence: 927 a.a.     [Download]
>gi|46447074|ref|YP_008439.1| conjugative transfer protein traG [Candidatus Protochlamydia amoebophila UWE25]
MIPLFLASDLTIHTYGGGEILQKVFVAIAMLSGEGGMVFPLMFLCAALGFGFMVCQLLVTLSFDRFFTHY
FVPFLVIYTAFIIPKTTIHIEDALHKPKIYKVDHVPRLLAHFAEIASSIGYYATCGVEKAMHTVDDVKYS
QTGLIFGSDTALDYRRFQLTNPDLQKDFKEFSKQCVLYDLALGRYSLKELKTSTDLWKFLKERTSTLGMI
YYCPPTAKGGTKKEACEYLTCRQALEKFEPLFSKEKAYYAKQEIGKNLPLTFQALTHIKQDSQTLISQQL
MMHVLADSFSPEKFAQERAHLQQNSTYQAAGFTAAKGIVYMRVLFEALIYTSFLFVLPLSLLPSGIKILM
NWAWSVVWIQFWPPFYAILNYLASIVAKHTTAGIADGLAEKGLSIFTSVGIENFANDTFALAGYLTLSVP
FLSYVLLQGGLSQFVQLAGTLTSPAQSAASAAAGEQISGNYSYDNISMGQTSYGNTTAFQNQLAPSVSDG
YFIENNGSERMDYTSSGVIYTQNASNLTSSINADQVFGESLQHQKQHATSYAETTSQQYQESLSAATNVG
SNLVSHLAHADQFNEGFSSREAYDAQQSVRHMESAADNWGRQYGLSSKQSMDFAMAGAIGGELGVNQLLN
SITGVGLSASGRGTAGYNFGADESKFVSAATNFAQSEEFQSNFLKVKDYAMTQASSSSMDEGVRLAQDFT
QSLSEVQNSQESYQIAQTQLDQISETGAWYQQNSHLIKDNLNQKYVDWAVERLNDQYQDGTGFERFKAIA
NGNTLENINQSQALVYEFVQTEMNKQAGIAHQIPADIDPQSSYMKAQVPQVHREEKLNEIFEDYTQQAQG
IQQVYGSQPKTREGLEQAYEQAKGTHDAYSYFTDHGIQYQRNATENRFDIERQKTLPKRAWKSTEAQTET
SQDYKLDVPFFWKRGES
 
Nucleotide Sequence: 2784 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1711791-1714574 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
ATGATCCCCCTATTTTTAGCGTCTGATTTAACGATTCATACTTATGGAGGAGGAGAAATTCTTCAAAAGG
TTTTTGTCGCCATTGCCATGTTATCTGGGGAAGGGGGGATGGTTTTTCCTTTGATGTTTCTTTGTGCTGC
TTTAGGGTTTGGTTTTATGGTTTGCCAACTTTTAGTCACTTTGTCATTTGATCGCTTTTTTACGCATTAT
TTTGTTCCTTTTCTCGTCATCTATACAGCTTTTATCATTCCGAAAACGACTATCCACATCGAAGATGCAT
TACATAAACCCAAAATTTACAAAGTCGACCATGTTCCTCGCTTGCTCGCTCACTTTGCCGAAATCGCTAG
TTCAATTGGCTATTATGCAACATGTGGCGTGGAAAAAGCGATGCATACTGTCGATGATGTCAAATATAGT
CAGACAGGATTAATTTTTGGCTCCGACACTGCCTTGGATTATCGACGCTTTCAATTGACCAACCCCGATT
TGCAAAAAGATTTTAAAGAATTTTCTAAACAATGTGTGCTTTACGATTTGGCACTTGGGCGCTACTCCCT
CAAAGAATTAAAAACCTCTACTGATCTTTGGAAATTTTTAAAAGAACGAACTTCAACGCTTGGAATGATT
TATTATTGTCCGCCAACAGCCAAAGGGGGAACAAAAAAAGAGGCCTGTGAATACCTGACCTGCAGGCAAG
CTTTAGAGAAATTTGAACCTCTATTTAGCAAAGAAAAGGCTTATTATGCGAAGCAAGAAATTGGGAAAAA
TTTGCCTTTGACTTTTCAGGCTTTAACCCACATCAAGCAAGATAGCCAAACTTTAATTAGTCAACAGCTC
ATGATGCATGTGCTAGCAGATTCATTTAGCCCTGAGAAATTTGCGCAAGAAAGAGCACATCTTCAGCAAA
ACTCCACCTATCAAGCTGCCGGTTTTACCGCTGCAAAAGGAATTGTGTACATGCGAGTGCTTTTTGAAGC
CTTGATTTATACCTCCTTTCTTTTTGTGCTTCCTTTATCTTTACTTCCAAGCGGAATTAAAATACTCATG
AATTGGGCGTGGTCAGTTGTCTGGATTCAGTTTTGGCCACCTTTTTATGCCATTTTGAATTATTTGGCTT
CGATTGTGGCAAAACATACCACAGCTGGCATCGCAGATGGTTTGGCGGAAAAAGGGCTTAGCATTTTTAC
AAGTGTCGGAATTGAAAACTTTGCCAATGACACATTTGCCTTAGCGGGATACTTAACGCTGAGCGTTCCT
TTTCTTAGTTATGTGCTTTTACAGGGAGGATTGAGTCAATTTGTTCAACTTGCCGGTACGCTTACCTCCC
CTGCGCAAAGTGCTGCCTCTGCAGCGGCTGGAGAACAAATCTCTGGCAATTACTCTTATGACAATATCAG
CATGGGCCAAACCTCCTATGGGAATACCACAGCTTTTCAAAATCAGTTAGCGCCCTCTGTTTCCGATGGA
TATTTCATAGAAAATAATGGATCCGAAAGGATGGATTATACCTCTAGTGGGGTCATTTATACGCAAAATG
CTTCGAACCTAACCAGTAGTATTAACGCCGATCAAGTTTTCGGGGAAAGTCTCCAACATCAAAAGCAACA
TGCGACCTCTTATGCAGAAACGACGAGTCAGCAATACCAAGAGAGCCTATCTGCAGCTACCAATGTGGGA
TCCAATTTAGTCAGTCACTTGGCCCATGCGGATCAATTCAATGAAGGATTCTCTTCACGAGAAGCTTATG
ATGCGCAGCAATCTGTGAGACATATGGAATCGGCAGCCGATAACTGGGGACGCCAATATGGCCTTAGCTC
CAAACAAAGTATGGATTTTGCCATGGCCGGTGCCATTGGAGGGGAACTGGGAGTTAATCAACTTCTTAAT
TCAATTACCGGGGTGGGATTAAGTGCCAGCGGCAGAGGGACAGCGGGCTATAATTTTGGGGCTGATGAGA
GTAAATTTGTCAGCGCTGCGACGAATTTTGCACAAAGTGAAGAATTTCAAAGCAACTTCCTAAAAGTCAA
AGATTACGCTATGACACAAGCCTCCTCCTCCTCGATGGATGAAGGCGTTCGCTTGGCGCAAGACTTTACG
CAATCGTTAAGTGAAGTGCAAAACTCGCAAGAATCTTACCAAATTGCCCAGACTCAGCTTGACCAAATCT
CTGAGACAGGAGCTTGGTATCAACAAAACTCCCATTTAATCAAAGACAATCTCAATCAAAAATATGTGGA
TTGGGCTGTTGAGCGCTTGAATGATCAGTACCAAGATGGAACCGGGTTTGAGCGTTTCAAAGCGATCGCA
AATGGGAATACCCTTGAGAATATCAATCAATCCCAAGCCCTTGTGTATGAATTTGTGCAAACGGAAATGA
ATAAGCAAGCAGGAATTGCTCATCAAATCCCGGCGGATATAGATCCTCAATCTTCTTATATGAAAGCTCA
AGTGCCGCAAGTCCATCGAGAAGAAAAATTAAACGAAATTTTTGAGGACTATACGCAGCAAGCGCAAGGA
ATTCAACAAGTGTATGGATCTCAGCCAAAAACGCGAGAGGGCCTTGAACAAGCCTATGAGCAAGCAAAAG
GAACGCATGATGCTTATTCTTACTTTACCGATCATGGCATTCAGTATCAGCGCAATGCCACAGAAAATCG
CTTTGATATAGAAAGACAAAAAACTCTTCCCAAACGTGCCTGGAAATCAACGGAAGCCCAAACGGAAACC
TCGCAAGATTACAAATTAGATGTTCCATTTTTTTGGAAACGAGGAGAGTCATGA
 Primer design