SecReT4
Protein ID: 46447075
T4SS name [ID]Tra_F [551]
Gene symboltraD
Locus tagpc1441
StrainCandidatus Protochlamydia amoebophila UWE25
Repliconchromosome [GenBank: NC_005861] [Browse all T4SS(s) in this replicon]
Location [Strand]1714571..1716241 [+]
Productconjugative transfer protein traD
Component typeTraD_F
UniProt IDQ6MB84
KEGG IDpcu:pc1441
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2.1e-138, Aligned region: 169..551
TraG-D_C [PF12696], Evalue: 6.7e-21, Aligned region: 410..529
T4SS-DNA_transf [PF02534], Evalue: 1.8e-15, Aligned region: 183..540
AAA_10 [PF12846], Evalue: 6.2e-13, Aligned region: 183..221
AAA_10 [PF12846], Evalue: 6.2e-13, Aligned region: 414..489
T2SE [PF00437], Evalue: 2.2e-05, Aligned region: 182..217
FtsK_SpoIIIE [PF01580], Evalue: 7e-05, Aligned region: 180..208
Protein Sequence: 556 a.a.     [Download]
>gi|46447075|ref|YP_008440.1| conjugative transfer protein traD [Candidatus Protochlamydia amoebophila UWE25]
MKLFQTITEGGQLTTHSVRMFKQVTKTSFFITFVLWIIVFLYQMRDVNTFYLQNVLYFEQARFYQVLHID
TIKVDPSFGLQRGSQDVKEYTTDQVLRLTKPYADRFYRITKQRFQHSAFWALAPLSVVFAIFFFRGRQSI
KKHHLKGNTLSSVWLTRWKLKLSRRASPISIGSLPLIKGTETQHIMITGGTGSGKTNCLHHLLKSVRQQK
QRAIIVDTTGLLTERYYRAGKDILLNPLDSRGAPWHPWIECIDKTSYATMAESFIPQSLSDSDNYWRTSA
RIVLGSLFEQLKDIQKNSTLADKILRDPLQELCDFVQGTKAASLIDMNSEKTAASIRAVMSNFLTCFELL
ANTDQPFSIREWIQQEDPIDNWLFISCKTNERAALNPLLSCWLSVAVRSLLALPPNFERRLWYIIDELPT
LNRLRDLDMLLAESRKYGGCAVLALQSPAQLEAIYGQAVAQTLIGNCATKIVFAEQNPLHAGRLADMFGE
QEIREYQKGLSYGANDIRDGVSLNQQTRYQQLITKTDIQFLSRNQAFVRLPDNCPIVRLNVPILPR
 
Nucleotide Sequence: 1671 bp     [Download]
>gi|46445634|ref|NC_005861.1|:1714571-1716241 Candidatus Protochlamydia amoebophila UWE25 chromosome, complete genome
ATGAAGCTATTTCAAACTATCACCGAAGGAGGTCAATTAACCACGCACAGTGTGCGTATGTTCAAGCAGG
TTACGAAAACCTCTTTTTTTATTACCTTTGTCTTGTGGATTATCGTTTTCCTTTACCAAATGCGGGATGT
GAATACGTTTTATCTCCAAAATGTTTTGTACTTTGAGCAAGCACGTTTTTATCAAGTGCTTCACATTGAT
ACGATTAAGGTAGATCCCTCTTTTGGTTTGCAAAGGGGAAGTCAGGATGTTAAGGAATACACCACAGATC
AAGTTCTTCGTCTAACTAAGCCTTATGCAGACCGCTTTTATCGCATCACCAAACAAAGATTTCAGCACTC
TGCTTTTTGGGCGCTTGCCCCTCTTTCTGTCGTCTTTGCCATTTTCTTCTTTCGAGGAAGACAATCCATT
AAAAAACACCATCTAAAAGGAAATACCCTCTCTTCCGTCTGGTTAACACGGTGGAAACTAAAACTATCGC
GTCGCGCCTCTCCCATTTCCATCGGATCGCTTCCTCTCATCAAAGGAACAGAAACACAACACATCATGAT
TACGGGCGGAACGGGTAGTGGTAAGACGAATTGCTTACATCATCTATTAAAGTCCGTGCGTCAGCAAAAG
CAACGAGCAATTATTGTCGATACCACAGGTCTTTTAACGGAGCGGTATTATCGCGCTGGCAAAGATATTT
TGTTAAATCCCCTAGATTCGCGGGGAGCTCCTTGGCACCCTTGGATCGAATGCATAGACAAAACTAGTTA
TGCGACTATGGCAGAAAGTTTCATTCCTCAAAGTCTTTCCGATAGTGATAATTATTGGCGAACTTCAGCG
CGTATCGTTTTAGGTTCTTTATTTGAACAATTAAAGGATATTCAAAAAAACTCGACTTTAGCTGATAAAA
TTTTGCGAGATCCCCTTCAAGAGCTTTGTGATTTTGTCCAAGGAACAAAAGCCGCTTCGTTAATCGACAT
GAACTCAGAAAAAACGGCTGCCTCCATTCGCGCTGTGATGTCTAATTTTTTGACCTGCTTTGAGTTATTG
GCCAATACCGATCAACCGTTTTCAATTCGAGAATGGATCCAACAGGAAGATCCAATTGACAATTGGTTAT
TCATTAGTTGCAAAACGAATGAACGGGCAGCCCTCAATCCCCTACTCTCTTGTTGGCTATCTGTTGCTGT
ACGCAGTCTGTTGGCCTTGCCCCCAAATTTTGAACGAAGGCTTTGGTATATCATCGATGAGCTTCCGACC
TTAAATCGTTTGCGTGATTTAGACATGTTGCTGGCCGAGAGTCGCAAATACGGAGGCTGCGCCGTTCTGG
CTTTGCAAAGCCCTGCCCAGTTAGAAGCCATCTACGGGCAAGCTGTCGCTCAAACCTTGATCGGCAATTG
TGCCACCAAAATTGTCTTTGCTGAGCAAAATCCCCTTCATGCAGGTCGTCTTGCCGACATGTTCGGAGAG
CAAGAAATTAGAGAGTATCAAAAAGGGCTGTCTTATGGAGCCAATGACATTCGAGATGGGGTGAGTTTAA
ATCAACAAACGCGGTATCAACAATTGATTACCAAGACTGATATTCAATTTCTGTCTCGTAACCAAGCCTT
TGTACGCTTACCTGATAATTGCCCGATTGTGCGTCTTAACGTACCTATTTTACCTAGATAA
 Primer design