SecReT4
Protein ID: 47104039
T4SS name [ID]Tra_F [542]
Gene symbol-
Locus tagPBPRC0014
StrainPhotobacterium profundum SS9
Repliconplasmid pPBPR1 [GenBank: NC_005871] [Browse all T4SS(s) in this replicon]
Location [Strand]12808..13599 [+]
Productsex pilus assembly and synthesis protein TraF
Component typeTraF_F
UniProt IDQ6LW83
KEGG IDppr:PBPRC0014
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.1e-68, Aligned region: 36..253
Protein Sequence: 263 a.a.     [Download]
>gi|47104039|ref|YP_015468.1| sex pilus assembly and synthesis protein TraF [Photobacterium profundum SS9]
MTLTPSLPFGALFFTTPLLVMAILTSPVTRAEQPPGWKWYNDPLLIKEKALTPPPPTPSVTVTRTLSPTQ
QMQWFHRYHDDTKNDALINKDDVKKAEKLMLLNQFAYNMSSDFGMTFQKALLMNPDLSYTKDRPTEQAAR
STYLQMEREKKIRAVRQLAGSGWGLFFVYEGASPMAEKLAPSVQQFADAHGIEVLGISLDGTQLASIHQN
RDNSNHIQVPFSPALVLVNPNTQEMKPLAYGFIAQEDLLGRFLNVATDFAPDF
 
Nucleotide Sequence: 792 bp     [Download]
>gi|47104025|ref|NC_005871.1|:12808-13599 Photobacterium profundum SS9 plasmid pPBPR1, complete sequence
ATGACACTGACACCCTCATTGCCCTTCGGGGCACTGTTTTTTACCACTCCTTTATTAGTGATGGCCATAC
TGACCAGCCCAGTCACCCGTGCCGAACAACCACCCGGTTGGAAGTGGTATAACGATCCGTTATTGATCAA
AGAAAAAGCCCTGACACCACCACCGCCCACCCCGTCGGTCACGGTGACACGCACTCTCTCACCGACCCAG
CAAATGCAATGGTTTCATCGCTACCACGATGACACCAAGAACGATGCCCTGATTAATAAGGACGATGTAA
AAAAGGCAGAAAAGCTCATGCTGCTCAATCAATTTGCGTACAACATGTCGTCTGATTTTGGCATGACCTT
TCAAAAAGCCCTGCTCATGAACCCGGACCTGTCCTACACCAAAGACCGTCCGACGGAACAAGCCGCCCGC
TCCACCTACCTGCAGATGGAGCGGGAAAAGAAAATTCGGGCCGTGCGCCAACTGGCAGGTAGTGGCTGGG
GCTTATTTTTCGTCTATGAAGGGGCTTCCCCCATGGCCGAAAAACTGGCTCCCTCAGTACAACAATTTGC
TGATGCCCACGGCATTGAGGTACTTGGCATTAGCCTTGACGGTACACAGCTGGCCAGCATTCACCAGAAT
CGGGATAACAGCAATCATATCCAAGTGCCCTTTAGTCCCGCCTTGGTCCTGGTCAACCCCAACACCCAAG
AAATGAAACCCCTCGCCTACGGGTTCATTGCTCAAGAAGACTTATTGGGGCGCTTTTTGAACGTCGCCAC
TGACTTTGCCCCTGACTTTTAA
 Primer design