SecReT4
Protein ID: 49176920
T4SS name [ID]Trb [65]
Gene symboltrbC
Locus tagpJP4_59
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]59222..59686 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ6UP62
KEGG IDreu:Reut_D6503
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-18, Aligned region: 12..110
Protein Sequence: 154 a.a.     [Download]
>gi|49176920|ref|YP_025423.1| mating pair formation [Ralstonia eutropha JMP134]
MQATFPAFRLNRNALFYMGLFALLAFFLLAPQHAFASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGALHQVKVAALDVAGFPG
EAVMRWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|49176863|ref|NC_005912.1|:59222-59686 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGCAAGCAACCTTCCCGGCATTCCGCCTCAACCGCAACGCCCTGTTCTACATGGGCCTCTTCGCCCTCC
TGGCGTTCTTCCTGCTGGCCCCCCAGCACGCATTCGCCTCCGAGGGCACCGGCGGCTCTCTGCCGTATGA
GAGCTGGCTGACCAACCTCCGCAACTCCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTGGTCGCCGGCGGCATCCTGATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGCGCGCAGAACATGATGAGCACGTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGCGCTGCACCAGGTCAAGGTCGCCGCGCTGGACGTGGCCGGCTTCCCCGGC
GAAGCCGTCATGCGCTGGGCCGAGCGCGGCCACATCGCGGGGTAA
 Primer design