SecReT4
Protein ID: 49176921
T4SS name [ID]Trb [65]
Gene symboltrbD
Locus tagpJP4_60
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]59690..60001 [+]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDQ6UP61
KEGG IDreu:Reut_D6504
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.6e-26, Aligned region: 1..87
Protein Sequence: 103 a.a.     [Download]
>gi|49176921|ref|YP_025424.1| mating pair formation [Ralstonia eutropha JMP134]
MALRAIPIRRAGNRENLFMGGDRELVMFSGLLAGALIFSAQEVRATVFGIALWFGALFALRLMAKADPKL
RHVYLRHRRYKPYYPARSTPFRDNTPSQGKQYK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|49176863|ref|NC_005912.1|:59690-60001 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGGCTCTGCGCGCGATCCCCATCCGTAGGGCCGGCAACCGAGAAAACCTGTTCATGGGCGGGGATCGTG
AGCTGGTGATGTTCTCGGGCCTGCTGGCCGGCGCGCTGATTTTCAGCGCCCAAGAAGTGAGGGCAACGGT
GTTCGGCATCGCCTTGTGGTTCGGCGCGCTCTTCGCGCTGCGCCTCATGGCGAAGGCCGATCCGAAGCTG
CGACACGTGTACCTGCGGCACCGCCGGTACAAGCCGTACTACCCGGCTCGCAGCACGCCCTTCCGTGACA
ACACGCCGAGTCAAGGGAAGCAATACAAATGA
 Primer design