SecReT4
Protein ID: 49176922
T4SS name [ID]Trb [65]
Gene symboltrbE
Locus tagpJP4_61
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]59998..62556 [+]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDQ6UP60
KEGG IDreu:Reut_D6505
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.7e-56, Aligned region: 218..431
AAA_10 [PF12846], Evalue: 2.9e-29, Aligned region: 489..770
Protein Sequence: 852 a.a.     [Download]
>gi|49176922|ref|YP_025425.1| mating pair formation [Ralstonia eutropha JMP134]
MIEAIAIAIAVLGAVLLLILFARIRAVDAELKLKKHRAKDAGLADLLNYAAVVDDGVIVGKNGSFMAAWL
YKGDDNASSTEEQREMVSFRINQALAGLGNGWMVHVDAVRRPAPNYSERGVSSFPDSVSFAIDEERRRLF
EGLGAMFEGYFVLTVTWFPPVLAQRKFVELMFDDDAVAPDHTARTTGLIAQFKREITSLESRLSSAVKMT
RLRGQKVVSEEGREVTHDDFLSWLQFCVTGLHHPVMLPSNPMYLDAVIGGQELWGGVVPKIGRKFIQVVA
IEGFPLESTPGVLSALAELPSEYRWSSRFIFMDQHESLKHLDKFRKKWKQKIRGFFDQVFNTNTGSINQD
AAAMVGDAEAAIAEVNSGLVAAGYYTSVVVLMDEDRERLAASALLVEKAVNRLAFAARIETINTLDAYLG
SLPGHGVENVRRPLINTMNLADLLPTSSIWTGSATAPCPMYPPLSPALMHCVTVGATPFRLNLHVRDLGH
TFMFGPTGAGKSTHLGIIAAQLRRYAGMSIYAFDKGMSMYPLAAGIRAATKGKSGLHFTVAADDDRLAFC
PLQFLETKGDRAWAMEWIDTILALNGVNTTPAQRNEIGNAIMSMHASGARTLSEFSVTIQDEAIREAIKQ
YTVDGSMGHLLDAEEDGLSLSDFTVFEIEELMNLGEKFALPVLLYLFRRIERALKGQPSVIILDEAWLML
GHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTSALYRRMG
LNARQIEILATAIPKRQYYYVSENGRRLYDLALGPMALAFVGASDKESVATIKSLEAKFGHEWVHEWLAG
RGLNLNDYLEAA
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|49176863|ref|NC_005912.1|:59998-62556 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGATCGAAGCAATCGCAATTGCCATTGCTGTGCTCGGTGCGGTTCTGTTGCTCATCCTCTTTGCCCGCA
TCCGGGCTGTCGATGCCGAGCTGAAGCTCAAGAAGCATCGCGCCAAGGATGCCGGCCTGGCCGATCTGCT
CAATTACGCCGCCGTGGTCGATGACGGCGTGATCGTGGGCAAGAACGGCTCCTTTATGGCCGCCTGGCTG
TACAAGGGTGATGACAACGCCAGCAGCACCGAGGAACAGCGGGAAATGGTGTCGTTCCGCATCAACCAGG
CCCTGGCGGGCCTGGGGAACGGCTGGATGGTGCATGTCGATGCTGTGCGTCGGCCTGCGCCGAACTACTC
GGAGCGGGGCGTGTCATCGTTCCCCGACTCCGTTTCCTTCGCCATTGACGAGGAACGCCGGCGCTTGTTC
GAGGGCCTGGGCGCGATGTTCGAGGGCTACTTTGTCCTGACCGTCACGTGGTTCCCGCCAGTGCTGGCCC
AGCGCAAGTTTGTCGAACTCATGTTCGATGACGATGCGGTGGCTCCCGACCATACGGCGCGCACTACGGG
CCTGATTGCGCAGTTCAAGCGCGAGATCACCAGCCTGGAATCGCGCCTGTCCTCGGCGGTCAAGATGACG
CGCCTGCGCGGCCAAAAAGTCGTGTCGGAAGAGGGCAGGGAAGTCACGCACGATGACTTCCTGAGCTGGT
TGCAGTTCTGCGTGACGGGCCTCCATCACCCGGTCATGCTGCCCAGCAATCCGATGTACCTCGATGCGGT
AATCGGCGGGCAAGAGCTGTGGGGCGGCGTCGTGCCCAAGATCGGGCGCAAGTTCATCCAGGTGGTCGCC
ATCGAAGGCTTCCCCTTGGAGTCAACGCCTGGGGTGCTCTCGGCCCTGGCCGAGCTGCCCAGCGAATACC
GCTGGTCGAGCCGCTTCATCTTCATGGATCAGCACGAGTCCTTGAAGCACCTGGACAAGTTCCGCAAGAA
GTGGAAGCAGAAGATTCGCGGCTTCTTCGATCAGGTGTTCAACACGAATACCGGCTCGATCAACCAGGAC
GCGGCCGCGATGGTCGGCGACGCCGAGGCGGCCATCGCCGAGGTCAACAGCGGCTTGGTGGCGGCCGGCT
ACTACACCAGCGTAGTCGTGCTGATGGACGAGGATCGGGAGCGCCTGGCGGCCTCCGCGCTCCTGGTCGA
GAAGGCCGTCAACCGCCTGGCCTTCGCGGCCCGTATCGAGACGATCAACACGCTCGATGCGTACCTGGGC
AGCTTGCCCGGCCACGGCGTCGAGAACGTGCGCCGGCCGCTCATCAACACGATGAACCTGGCCGACCTGC
TGCCGACAAGCTCGATCTGGACGGGCAGCGCCACGGCTCCGTGCCCGATGTACCCGCCGCTGTCGCCGGC
GCTCATGCACTGCGTGACGGTGGGCGCTACGCCGTTCCGCCTGAACCTGCACGTGCGCGACCTGGGCCAC
ACCTTCATGTTCGGCCCGACCGGCGCAGGCAAATCGACGCACCTGGGCATCATCGCCGCGCAGCTCCGTC
GCTACGCCGGCATGTCGATCTACGCCTTCGACAAGGGCATGTCGATGTACCCACTCGCGGCCGGCATCCG
CGCGGCCACGAAGGGCAAGAGCGGCCTGCATTTCACGGTGGCCGCCGACGATGACCGCCTGGCGTTCTGC
CCGCTCCAGTTCCTCGAAACGAAGGGGGATAGGGCCTGGGCGATGGAGTGGATCGACACCATCCTGGCGT
TGAACGGCGTCAACACCACGCCGGCGCAGCGCAACGAGATCGGCAACGCGATCATGAGCATGCACGCCAG
CGGCGCGCGCACGCTCTCCGAGTTCTCGGTGACGATTCAGGACGAGGCGATCCGCGAGGCCATCAAGCAG
TACACGGTGGACGGCTCGATGGGCCACCTGCTCGACGCCGAAGAGGACGGCCTGTCGCTGTCCGACTTCA
CGGTGTTCGAGATCGAAGAGCTGATGAACCTGGGCGAGAAGTTCGCGCTGCCGGTGCTGCTCTACCTGTT
CCGCCGCATCGAGCGCGCACTGAAAGGCCAGCCCTCCGTCATCATCCTGGACGAAGCCTGGTTGATGCTG
GGCCACCCCGCGTTCCGCGCCAAGATCAGGGAATGGCTCAAGGTGCTGCGCAAGGCCAACTGCCTTGTGC
TGATGGCGACGCAAAGCCTCTCCGACGCGGCCAACTCGGGCATCTTGGACGTGATCGTGGAATCGACCGC
GACCAAGATTTTCCTGCCTAACGTCTACGCCAGGGATGAGGACACATCGGCGCTCTATCGCCGTATGGGC
CTCAACGCGCGTCAGATCGAAATCCTGGCGACTGCCATTCCGAAGCGTCAGTACTACTACGTCTCGGAGA
ACGGCCGCCGTCTCTATGACCTTGCCCTGGGGCCGATGGCCCTGGCCTTCGTCGGTGCGTCCGACAAGGA
ATCGGTCGCCACCATCAAGAGCCTCGAAGCCAAGTTCGGCCACGAATGGGTGCATGAGTGGCTGGCCGGC
CGTGGGCTGAATCTCAACGACTACCTGGAGGCCGCATGA
 Primer design