SecReT4
Protein ID: 49176923
T4SS name [ID]Trb [65]
Gene symboltrbF
Locus tagpJP4_62
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]62553..63335 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ6UP59
KEGG IDreu:Reut_D6506
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.4e-59, Aligned region: 46..258
Protein Sequence: 260 a.a.     [Download]
>gi|49176923|ref|YP_025426.1| mating pair formation [Ralstonia eutropha JMP134]
MSIADTLKGLIFKKPANSAEPRDPRRSKEPLAGGRRAGEAENPYLAARRTWNDHVGSVVSQRQTWQVIGI
LSLLIALAGVGGVIHIGSQSKFIPYVVEVDKLGQTVAAGPVQAAGKADPRVIHAAVADWMSCARMVSPDV
ALQRKCVFKAYSMLAPNDPATPKMNEWLNGTPDSSPFKRAEKEMVSVEIKTVIPQTPDTWQVEWVETTRD
RQGTLKGQPVTWRALVTTYIAEVTPNTTDEQLRNNPLSIYVRDYSWSRIQ
 
Nucleotide Sequence: 783 bp     [Download]
>gi|49176863|ref|NC_005912.1|:62553-63335 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGAGCATCGCCGACACCCTCAAGGGCTTGATCTTCAAGAAGCCCGCCAACTCCGCCGAGCCGCGCGATC
CGCGCCGCTCGAAGGAACCGCTCGCCGGCGGCCGCCGTGCGGGCGAGGCCGAGAACCCCTACCTGGCCGC
GCGCCGCACCTGGAACGATCACGTGGGCAGCGTCGTCTCGCAGCGCCAAACCTGGCAGGTGATAGGCATC
CTGTCGCTGTTGATCGCGCTGGCCGGCGTGGGTGGCGTGATCCACATCGGCAGCCAGTCGAAGTTCATCC
CCTACGTGGTCGAGGTGGACAAGCTGGGCCAGACGGTGGCCGCCGGCCCGGTGCAGGCCGCAGGGAAGGC
CGATCCGCGTGTCATCCACGCCGCCGTTGCGGACTGGATGAGCTGCGCGCGCATGGTGTCGCCTGACGTG
GCCTTGCAGCGCAAGTGCGTGTTCAAGGCGTACTCGATGCTCGCCCCCAACGATCCGGCGACGCCAAAGA
TGAACGAGTGGTTGAACGGCACGCCCGATTCCAGCCCGTTCAAGCGCGCCGAGAAGGAAATGGTCAGCGT
CGAGATCAAGACCGTCATCCCGCAAACGCCCGACACCTGGCAAGTCGAGTGGGTGGAAACCACGCGCGAC
CGCCAAGGCACGCTGAAAGGTCAGCCCGTCACCTGGCGCGCGCTCGTGACTACCTACATCGCCGAGGTCA
CGCCCAACACCACCGATGAGCAACTGCGGAACAACCCGTTGAGCATCTACGTGCGTGATTACTCCTGGTC
CCGCATCCAATGA
 Primer design