SecReT4
Protein ID: 49176924
T4SS name [ID]Trb [65]
Gene symboltrbG
Locus tagpJP4_63
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]63332..64252 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ6UP58
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.5e-66, Aligned region: 80..305
Protein Sequence: 306 a.a.     [Download]
>gi|49176924|ref|YP_025427.1| mating pair formation [Ralstonia eutropha JMP134]
MNSRSSTMKKTLSALIVGAAVAVPSLALAAPGDDIADKYFNKTNPTLTAQERAALAIAKRWEAGSATGIK
PVAGSGGAIKFVYGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGATEVQHLIIKP
MDVGLETSLVVTTNRRSYHFRLRSHRTEYMPQVSFTYPEEAQAKWDAIQRREKQERTDNTLPATGEYLGD
LSFDYELSGSASWKPVRVYNDGRKTIIEMPGTMQQTEAPTLLVVRKEGGLFTDDETVLVNYRVQGNRYIV
DTVFDRAILIAGVGSSQDRVTISRRK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|49176863|ref|NC_005912.1|:63332-64252 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGAATTCGAGGTCATCCACCATGAAGAAAACCCTCTCCGCTTTGATCGTGGGCGCTGCTGTGGCGGTGC
CCTCCCTGGCTCTGGCCGCCCCTGGCGACGACATTGCCGACAAGTATTTCAACAAGACCAACCCGACGCT
GACCGCTCAAGAGCGCGCGGCGCTCGCCATCGCCAAACGGTGGGAAGCGGGGTCGGCGACCGGCATCAAG
CCGGTGGCCGGCTCGGGCGGTGCCATCAAGTTCGTGTACGGCGCGCAGCAGCCGAGCATCGTTTGCGCGG
TGCTCCAGGTGTGCGACGTGGCCTTGCAGCCCGGCGAACAAGTGAACTCGATCAACCTGGGCGACACGGC
CAGGTGGACGGTGGAACCGGCCATCACCGGCAGCGGCGCGACCGAGGTTCAGCACCTCATCATCAAGCCG
ATGGACGTGGGCCTCGAAACCAGCCTGGTTGTGACCACGAACCGCCGCAGCTACCACTTCCGCCTGCGCT
CGCATCGCACCGAGTACATGCCGCAAGTCTCGTTCACGTACCCCGAGGAAGCGCAAGCCAAGTGGGACGC
GATCCAGCGCCGCGAGAAGCAGGAACGCACCGACAACACCCTGCCGGCGACGGGCGAGTACCTGGGCGAT
CTCTCGTTCGACTATGAGCTGTCCGGGTCGGCGAGCTGGAAGCCTGTGCGCGTCTACAACGATGGCCGCA
AGACCATCATCGAAATGCCCGGCACGATGCAGCAGACCGAAGCGCCGACGCTCCTGGTCGTGCGCAAAGA
GGGCGGCTTGTTCACCGACGACGAAACGGTGCTGGTCAATTACCGCGTGCAGGGCAATCGCTACATCGTG
GACACGGTGTTTGACCGCGCGATCCTGATTGCCGGTGTTGGCAGTAGCCAAGACCGCGTGACCATCAGCC
GGAGGAAGTGA
 Primer design