SecReT4
Protein ID: 49176925
T4SS name [ID]Trb [65]
Gene symboltrbH
Locus tagpJP4_64
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]64255..64743 [+]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDQ6UP57
KEGG IDreu:Reut_D6508
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 7.1e-49, Aligned region: 33..162
Protein Sequence: 162 a.a.     [Download]
>gi|49176925|ref|YP_025428.1| mating pair formation [Ralstonia eutropha JMP134]
MRKIVSLALLALALGLGGCATTSQYGNFVQSAALDQQKLATDAVQQLATLYAPARTRLELQQPTPDPFGQ
ALVKSLRDKGYALLEYAPAGASTQAPASAASQASAPATTAASGGLPLRYVLDQAGDSNLYRLTLMVGNQS
ITRPYLAQNGTFAPAGYWVRKE
 
Nucleotide Sequence: 489 bp     [Download]
>gi|49176863|ref|NC_005912.1|:64255-64743 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGCGCAAGATCGTCTCTCTCGCGCTGCTCGCCCTCGCCCTGGGCCTCGGCGGCTGCGCAACCACCAGCC
AGTACGGCAACTTCGTCCAGTCGGCCGCGCTCGATCAGCAGAAGCTCGCCACCGACGCGGTGCAGCAGCT
CGCCACGCTGTACGCGCCGGCGCGCACGCGCCTGGAGCTGCAACAGCCGACGCCCGATCCGTTCGGCCAG
GCGCTCGTCAAGTCGCTGCGCGACAAGGGCTATGCCCTCCTGGAGTACGCCCCGGCCGGCGCTTCCACGC
AGGCCCCGGCCTCGGCGGCATCGCAGGCGAGCGCACCGGCCACCACGGCCGCGTCGGGCGGCCTGCCGTT
GCGCTACGTGCTCGACCAGGCTGGCGACTCGAACCTGTACCGCCTGACCTTGATGGTCGGCAATCAATCC
ATCACCCGCCCTTACCTGGCGCAAAACGGCACGTTCGCGCCGGCCGGGTACTGGGTGCGCAAGGAGTGA
 Primer design