SecReT4
Protein ID: 49176926
T4SS name [ID]Trb [65]
Gene symboltrbI
Locus tagpJP4_65
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]64748..66169 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDQ6UP56
KEGG IDreu:Reut_D6509
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.3e-65, Aligned region: 279..464
Protein Sequence: 473 a.a.     [Download]
>gi|49176926|ref|YP_025429.1| mating pair formation [Ralstonia eutropha JMP134]
MTENADQMAPDASPGEVSKKAGVRRVNNMPMYILGGVLLSFVLVMALVAADRAAKQNAPADGPKEKAGNT
SMFAKEIAGDKTGGLIEPASPLKVPDMPTGPASAPLEIARPSNPDAPPAPPANPGNPGQPVNDDEAQRIR
MAKMQMFGEAVKAKTTVRVDAPRSNGSAPGGPSTYTGTPQTRDEMLNRIAAVQQQIDAQRSNDPTAAYQA
RLAQIRGMGVGGGGAAPAAGGMGAGGAPQLLQTSTSGGGRNSMAQFGQGGQGDRWKLDSQPEAPRTPFEL
RAGFVVPATLISGINSDLPGQIMAQVAQDVYDTPTGKHLLIPQGSRLVGSYSSDVAYGQARVLVAWQRIV
FPDGKAMDIGAMPGADSAGYAGFHDQVNNHYVRLFGSAFLMSGVTAGITYSQRQNQATNTYGAPSASSAL
SEALGQQLGQVTAQLIAKNLSISPTLEIRPGYRFNVVVTKDMTFSKPYRSFDY
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|49176863|ref|NC_005912.1|:64748-66169 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGACAGAAAACGCCGATCAGATGGCACCTGACGCTTCGCCTGGCGAAGTGTCCAAGAAGGCGGGCGTCC
GTCGCGTCAACAACATGCCCATGTACATCCTCGGCGGCGTCCTGCTGTCGTTCGTGCTGGTCATGGCCCT
GGTCGCGGCGGATCGCGCGGCCAAGCAGAACGCGCCGGCGGACGGCCCCAAGGAGAAGGCCGGCAACACG
TCGATGTTCGCCAAGGAGATCGCAGGCGACAAGACCGGCGGCTTGATCGAGCCGGCAAGCCCGCTCAAGG
TGCCCGACATGCCGACCGGCCCGGCGTCGGCTCCGCTGGAGATCGCGCGGCCGTCCAACCCGGACGCGCC
GCCGGCCCCGCCGGCCAACCCCGGCAACCCGGGCCAGCCGGTGAACGACGACGAGGCCCAGCGCATCCGC
ATGGCGAAGATGCAGATGTTCGGCGAAGCCGTGAAGGCCAAGACCACCGTGCGCGTGGATGCCCCGCGTA
GCAACGGCTCCGCGCCGGGTGGCCCGAGCACCTACACCGGCACGCCGCAGACGCGCGATGAAATGCTGAA
CCGCATCGCAGCGGTGCAGCAGCAAATCGACGCGCAGCGCAGCAACGATCCGACCGCCGCCTATCAAGCA
CGCCTGGCGCAGATTCGCGGCATGGGCGTCGGTGGTGGCGGCGCGGCTCCGGCCGCCGGCGGCATGGGCG
CGGGCGGTGCGCCGCAGCTCCTGCAAACCTCGACCAGCGGCGGCGGGCGCAACAGCATGGCGCAGTTCGG
CCAAGGTGGGCAGGGCGACCGCTGGAAGCTGGATTCGCAGCCGGAAGCGCCGCGCACACCGTTCGAGCTG
CGCGCGGGCTTCGTCGTGCCGGCCACGCTCATTTCGGGCATCAACTCCGATCTGCCGGGCCAAATCATGG
CCCAGGTCGCGCAGGACGTGTACGACACACCGACCGGCAAGCACCTGTTGATCCCGCAGGGATCGCGCCT
CGTCGGCTCGTATTCGAGCGACGTGGCCTACGGCCAAGCGCGCGTGCTGGTTGCGTGGCAACGCATCGTG
TTCCCCGATGGCAAGGCGATGGACATTGGCGCGATGCCAGGCGCGGACAGCGCGGGATACGCGGGCTTCC
ACGACCAGGTGAACAACCACTATGTGCGCCTGTTCGGCTCGGCCTTCCTCATGTCCGGCGTGACAGCAGG
CATCACCTACAGCCAACGCCAGAACCAGGCCACAAACACCTATGGCGCACCGAGCGCCAGCAGTGCCCTA
AGCGAAGCCCTCGGCCAGCAGCTCGGCCAGGTTACGGCGCAACTCATCGCCAAGAACCTGAGCATTTCGC
CGACGCTGGAAATTCGGCCGGGGTATCGCTTCAACGTCGTGGTCACGAAGGACATGACGTTTTCCAAGCC
GTACCGTTCCTTCGATTACTAA
 Primer design