SecReT4
Protein ID: 49176927
T4SS name [ID]Trb [65]
Gene symboltrbJ
Locus tagpJP4_66
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]66190..66954 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ6UP55
KEGG IDreu:Reut_D6510
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 254 a.a.     [Download]
>gi|49176927|ref|YP_025430.1| mating pair formation [Ralstonia eutropha JMP134]
MKPKFLAAKLALVIAVSSTLAVTPVQAGIPVIDGTNLSQNIMTAIESVAQTLKQIEQYSTQLQQYQNQLQ
NTMAPAAYIWDQAQSTINGLMNAVNTLDYYKTQLGSLDSYIGKFQDVNYYKNSPCFTAAGCSDAERAALR
NVAQLASESQKKANDALFKGLDRQQTNLTADAATLQRLQSAAQGAQGQMQAIGYANQLASQQANQLLQIR
GLLIAQQNAMATKMQADADKEAQQAAAAAQLRQGSYRASPARTW
 
Nucleotide Sequence: 765 bp     [Download]
>gi|49176863|ref|NC_005912.1|:66190-66954 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGAAGCCGAAGTTTTTAGCCGCTAAATTGGCCCTCGTCATTGCTGTTTCGAGCACGCTGGCGGTCACAC
CTGTGCAGGCTGGCATCCCCGTCATCGACGGCACCAACCTGTCGCAGAACATCATGACGGCCATCGAATC
GGTGGCCCAGACGCTCAAGCAAATTGAGCAGTACAGCACCCAGCTCCAGCAGTATCAAAACCAACTCCAG
AACACGATGGCCCCGGCCGCGTATATCTGGGATCAGGCGCAATCGACCATCAACGGGTTGATGAACGCGG
TCAACACGCTGGATTACTACAAGACCCAACTCGGCAGCCTGGACAGCTACATCGGCAAGTTCCAGGACGT
GAACTACTACAAGAACTCGCCGTGCTTTACGGCGGCAGGGTGCTCCGACGCGGAACGCGCAGCACTTCGG
AATGTGGCCCAGCTCGCGAGCGAGTCGCAGAAGAAGGCCAACGATGCCTTGTTCAAGGGCCTCGATAGGC
AGCAAACGAATCTCACGGCCGATGCAGCGACGTTGCAGCGTCTTCAATCGGCAGCGCAGGGCGCGCAGGG
CCAAATGCAGGCCATCGGCTACGCCAACCAGCTCGCCAGCCAGCAGGCCAACCAGCTCTTGCAGATTCGT
GGCCTGCTGATCGCGCAGCAGAACGCGATGGCAACCAAGATGCAGGCCGACGCCGACAAGGAAGCCCAGC
AGGCGGCAGCGGCCGCACAACTGCGCCAGGGCAGCTACCGGGCCAGCCCGGCGCGCACCTGGTAA
 Primer design