SecReT4
Protein ID: 49176928
T4SS name [ID]Trb [65]
Gene symboltrbK
Locus tagpJP4_67
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]66964..67191 [+]
Productplasmid entry / exclusion
Component typeTrbK
UniProt IDQ6UP54
KEGG IDreu:Reut_D6511
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 75 a.a.     [Download]
>gi|49176928|ref|YP_025431.1| plasmid entry / exclusion [Ralstonia eutropha JMP134]
MKAIKALSLASAALVAALVAGCDNKPATAPMPEVNDENCKPENIAKIEDKGVQQAFSSLCLRRGGDFKPS
PKREW
 
Nucleotide Sequence: 228 bp     [Download]
>gi|49176863|ref|NC_005912.1|:66964-67191 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGAAAGCAATCAAGGCTCTGTCCTTGGCCTCGGCCGCCCTCGTGGCGGCCTTGGTCGCCGGCTGCGACA
ACAAGCCGGCCACGGCCCCCATGCCGGAAGTGAACGACGAGAACTGCAAGCCCGAGAACATCGCCAAGAT
CGAGGACAAGGGCGTCCAGCAGGCTTTTTCGTCGCTGTGCTTGCGTCGTGGTGGGGATTTCAAGCCCAGC
CCGAAACGCGAATGGTGA
 Primer design