SecReT4
Protein ID: 49176931
T4SS name [ID]Trb [65]
Gene symboltrbN
Locus tagpJP4_70
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]69539..70174 [+]
Productconjugal transfer protein TrbN
Component typeTrbN
UniProt IDQ6UP51
KEGG IDreu:Reut_D6514
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 211 a.a.     [Download]
>gi|49176931|ref|YP_025434.1| mating pair formation [Ralstonia eutropha JMP134]
MPFFADLPPQLQERVVCSISAAVKYEVPVNIVLAVAEKEGGKPGQWVRNSNGTHDVGPMQFNTAYLGDLA
RYGITANDVAAAGCYSFDLAAWRLRMHIRNDKGDLWTKAANYHSRTPQYNAVYRADLMRKASKWADWLEA
RFVTLDVTKAGATPSTPSQPATVAQRATPAARPAPAPQQAAPAAAAARSVSVAGYVPRTVSFNTSREGSA
E
 
Nucleotide Sequence: 636 bp     [Download]
>gi|49176863|ref|NC_005912.1|:69539-70174 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGCCGTTCTTCGCCGATCTGCCGCCGCAGCTCCAGGAGCGCGTCGTCTGCTCGATCTCGGCCGCCGTCA
AGTACGAGGTGCCGGTCAACATCGTGTTGGCCGTCGCCGAGAAAGAGGGCGGCAAGCCGGGCCAGTGGGT
GCGCAACTCGAATGGCACGCATGACGTTGGCCCGATGCAGTTCAACACCGCGTACCTGGGCGACCTGGCC
CGATACGGCATCACGGCGAACGATGTGGCGGCTGCCGGCTGCTACTCGTTCGACCTGGCCGCCTGGCGGC
TGCGGATGCACATCCGCAACGACAAGGGCGACCTCTGGACGAAGGCGGCGAACTACCACTCGCGCACGCC
GCAGTACAACGCGGTGTACCGGGCCGACTTGATGCGCAAGGCGTCGAAGTGGGCCGATTGGCTCGAAGCT
CGGTTCGTCACGCTTGACGTGACGAAGGCCGGGGCCACGCCCTCGACGCCCAGCCAGCCCGCGACGGTGG
CCCAGCGGGCGACGCCGGCGGCCAGGCCGGCACCAGCACCCCAGCAGGCCGCCCCAGCGGCCGCAGCAGC
TCGCAGCGTGTCGGTGGCCGGCTACGTGCCCCGCACGGTGTCTTTCAACACTTCACGCGAGGGGTCGGCC
GAGTAG
 Primer design