SecReT4
Protein ID: 49176942
T4SS name [ID]Trb [65]
Gene symboltraF
Locus tagpJP4_81
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]80621..81157 [-]
Productconjugal transfer peptidase TraF
Component typeTraF
UniProt IDQ6UP40
KEGG IDreu:Reut_D6524
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.7e-45, Aligned region: 32..177
Protein Sequence: 178 a.a.     [Download]
>gi|49176942|ref|YP_025445.1| maturation peptidase [Ralstonia eutropha JMP134]
MSRILKRIAAGVVIAGVAALLLAAGGYAAGARVNTTKSIPVGLYWTSSAPVEKGAYVLFCPPQLGVFDDA
KERGYIGAGFCQGGYGYMMKRVLAAKDDAVAVADDGVRVNGELLPLSAPIKADKAGRPLPRYQSNSYTLG
NSEVLLMSDVSATSFDGRYFGPINRSQIKTVIRPVITW
 
Nucleotide Sequence: 537 bp     [Download]
>gi|49176863|ref|NC_005912.1|:c81157-80621 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGAGCCGCATCCTGAAACGCATCGCGGCAGGCGTCGTCATCGCGGGCGTGGCCGCCCTGCTGCTGGCCG
CCGGCGGCTATGCCGCCGGTGCCCGCGTGAACACCACCAAGAGCATTCCGGTCGGCCTGTACTGGACGAG
CAGCGCGCCGGTGGAGAAGGGGGCCTACGTCCTCTTCTGCCCGCCGCAGCTCGGCGTGTTCGATGACGCC
AAGGAGAGGGGCTACATCGGGGCCGGCTTCTGCCAGGGCGGCTACGGCTACATGATGAAGCGCGTTTTAG
CCGCTAAAGACGATGCCGTCGCCGTCGCCGATGACGGCGTGCGCGTCAACGGCGAGCTGCTGCCCCTCAG
CGCGCCGATCAAGGCCGACAAGGCCGGTCGGCCGCTGCCGCGCTATCAGTCCAACAGCTACACGCTCGGC
AATTCCGAGGTGCTGCTTATGTCGGACGTGAGCGCCACATCCTTCGACGGCCGCTACTTCGGCCCGATCA
ATCGTTCGCAAATCAAGACCGTGATCCGTCCGGTCATCACCTGGTAG
 Primer design