SecReT4
Protein ID: 49176943
T4SS name [ID]Trb [65]
Gene symboltraG
Locus tagpJP4_82
StrainRalstonia eutropha JMP134 plasmid pJP4 (NC_005912)
Repliconplasmid pJP4 [GenBank: NC_005912] [Browse all T4SS(s) in this replicon]
Location [Strand]81154..83067 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ6UP39
KEGG IDreu:Reut_D6525
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.8e-162, Aligned region: 121..620
TraG-D_C [PF12696], Evalue: 1.9e-32, Aligned region: 444..568
TrwB_AAD_bind [PF10412], Evalue: 1.5e-26, Aligned region: 177..568
Protein Sequence: 637 a.a.     [Download]
>gi|49176943|ref|YP_025446.1| DNA transport protein [Ralstonia eutropha JMP134]
MKIKMNNAVGPQVRTAKPKPSKLLPVLGAASMVGGLQAATQFFAHTFAYHATLGPNVGHVYAPWSILHWT
YKWYSQYPDEIMKAGSMGMLVSTVGLLGVAVAKVVTSNSSKANEYLHGSARWAEKKDIQAAGLLPRERNV
LEIVTGKAAPTATGVYVGGWQDKDGNFFYLRHSGPEHVLTYAPTRSGKGVGLVVPTLLSWGASSVITDLK
GELWALTAGWRQKHAKNKVLRFEPASTSGGVCWNPLDEIRLGTEYEVGDVQNLATLIVDPDGKGLDSHWQ
KTAFALLVGVILHALYKAKDDGGTATLPSVDAMLADPNRDIGELWMEMATYGHVDGQNHHAIGSAARDMM
DRPEEEAGSVLSTAKSYLALYRDPVVARNVSRSDFRIKQLMHEDDPVSLYIVTQPNDKARLRPLVRVMVN
MIVRLLADKMDFEGGRPVAHYKHRLLMMLDEFPSLGKLEIMQESLAFVAGYGIKCYLICQDINQLKSRET
GYGHDESITSNCHVQNAYPPNRVETAEHLSRLTGQTTVVKEQITTSGRRTAAMLGQVSRTYQEVQRPLLT
PDECLRMPGPKKNAQGEIEEAGDMVIYVAGYPAIYGKQPLYFKDPVFSARAAIPAPKVSDRLRAVAQAET
EGEGITI
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|49176863|ref|NC_005912.1|:c83067-81154 Ralstonia eutropha JMP134 plasmid pJP4, complete sequence
ATGAAGATCAAGATGAACAACGCGGTAGGGCCGCAAGTCCGAACCGCCAAACCGAAGCCGAGCAAGCTGC
TGCCGGTGCTGGGCGCGGCCTCGATGGTCGGCGGCCTCCAGGCCGCGACGCAGTTCTTCGCCCACACGTT
CGCCTATCACGCGACCCTCGGCCCCAACGTGGGCCACGTGTACGCGCCCTGGTCGATCCTGCACTGGACG
TACAAGTGGTACAGCCAGTACCCGGACGAGATCATGAAGGCCGGCAGCATGGGGATGCTGGTTTCGACCG
TGGGCCTGCTGGGCGTGGCCGTGGCGAAGGTCGTCACGTCCAACAGCTCGAAGGCGAACGAGTACCTGCA
CGGCTCGGCCCGCTGGGCCGAGAAGAAGGACATTCAGGCGGCCGGCCTGCTGCCACGCGAGCGCAACGTC
CTGGAGATCGTCACCGGCAAGGCCGCACCCACGGCTACCGGCGTGTACGTGGGCGGCTGGCAGGACAAGG
ACGGCAATTTCTTCTACCTGCGGCACAGCGGCCCCGAGCACGTGCTGACCTACGCGCCCACGCGCTCGGG
CAAGGGCGTCGGCCTGGTGGTGCCCACGCTGCTGTCGTGGGGCGCGAGCAGCGTCATCACCGACTTGAAG
GGCGAGTTGTGGGCCTTGACCGCCGGCTGGCGGCAGAAGCACGCCAAGAACAAGGTGCTGCGCTTCGAGC
CGGCCAGCACCTCGGGCGGCGTCTGCTGGAATCCGCTGGACGAAATCCGCCTCGGCACCGAATACGAGGT
GGGTGACGTGCAGAACCTTGCCACGCTGATCGTTGACCCGGACGGCAAGGGCCTGGACTCGCACTGGCAG
AAGACCGCCTTCGCGCTCCTGGTCGGCGTGATCCTGCACGCGCTGTACAAGGCCAAGGACGATGGCGGCA
CCGCCACGCTGCCGTCCGTCGATGCGATGCTGGCCGACCCGAACCGGGACATTGGCGAGCTTTGGATGGA
AATGGCGACCTACGGGCACGTAGACGGCCAGAACCATCACGCCATCGGCTCGGCGGCCCGCGACATGATG
GATCGGCCCGAGGAAGAAGCCGGATCGGTGCTGTCCACGGCCAAGTCGTACCTGGCCCTGTACCGCGACC
CCGTGGTGGCCCGCAACGTCAGCCGGTCGGACTTCCGCATCAAGCAGTTGATGCACGAGGACGACCCGGT
AAGCCTCTACATTGTCACCCAGCCCAACGATAAGGCCCGCCTGCGGCCGCTGGTGCGCGTCATGGTGAAC
ATGATCGTGCGCCTGCTGGCCGACAAGATGGACTTCGAGGGCGGCCGGCCGGTGGCGCACTACAAGCACC
GGCTCTTGATGATGCTGGACGAGTTCCCGAGCCTCGGGAAGCTGGAGATCATGCAAGAGTCGCTGGCCTT
CGTGGCCGGCTACGGCATCAAGTGCTACCTCATCTGCCAGGACATTAACCAGCTCAAGAGCCGCGAGACG
GGCTACGGCCACGACGAAAGCATCACGTCGAACTGCCACGTGCAGAACGCCTACCCGCCCAACCGCGTCG
AGACGGCCGAACACCTGTCCCGCCTCACCGGGCAGACCACCGTGGTGAAGGAGCAGATCACGACCAGCGG
CCGCCGCACGGCGGCGATGCTGGGCCAGGTGTCGCGCACTTACCAGGAAGTGCAGCGGCCCTTGCTGACG
CCCGACGAATGCCTGCGCATGCCGGGGCCAAAGAAGAACGCCCAGGGCGAGATCGAAGAAGCCGGCGACA
TGGTGATCTACGTCGCGGGCTACCCGGCGATCTACGGCAAGCAACCCCTGTACTTCAAAGACCCAGTGTT
CTCGGCACGCGCCGCGATCCCTGCGCCCAAGGTCAGCGACCGCCTGCGCGCCGTCGCACAGGCCGAGACG
GAAGGGGAGGGCATCACGATATGA
 Primer design