SecReT4
Protein ID: 49188550
T4SS name [ID]VirB [431]
Gene symbolvirB7
Locus tagPMA4326A30
StrainPseudomonas syringae pv. maculicola plasmid pPMA4326A (NC_005918)
Repliconplasmid pPMA4326A [GenBank: NC_005918] [Browse all T4SS(s) in this replicon]
Location [Strand]24141..24455 [+]
ProductVirB7
Component typeVirB7
UniProt IDQ6J2H4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 104 a.a.     [Download]
>gi|49188550|ref|YP_025648.1| VirB7 [Pseudomonas syringae pv. maculicola]
MNVKLALSGLLSAALLSGCGSAPKLSEPEGQWEDMPFTHKPAPVPAAVIPATRPVPGQVRPAASPAPQAQ
PLKTTSQKRPATAASASPAKPAEVPPNDSKCSAN
 
Nucleotide Sequence: 315 bp     [Download]
>gi|49188520|ref|NC_005918.1|:24141-24455 Pseudomonas syringae pv. maculicola strain ES4326 plasmid pPMA4326A, complete sequence
ATGAATGTCAAACTTGCTTTGAGCGGGCTGCTTTCGGCTGCCTTGCTGTCAGGGTGTGGCTCTGCACCCA
AACTGTCCGAACCGGAAGGGCAGTGGGAAGACATGCCCTTCACCCACAAGCCTGCACCTGTACCAGCCGC
CGTGATACCGGCTACGCGCCCCGTGCCTGGCCAGGTACGGCCAGCGGCAAGCCCCGCGCCCCAGGCCCAG
CCGCTCAAGACCACCAGTCAAAAGCGCCCGGCAACTGCCGCAAGCGCCTCCCCGGCAAAGCCCGCCGAGG
TCCCGCCCAACGACTCCAAATGCTCCGCGAACTGA
 Primer design