SecReT4
Protein ID: 49188551
T4SS name [ID]VirB [431]
Gene symbolvirB8
Locus tagPMA4326A31
StrainPseudomonas syringae pv. maculicola plasmid pPMA4326A (NC_005918)
Repliconplasmid pPMA4326A [GenBank: NC_005918] [Browse all T4SS(s) in this replicon]
Location [Strand]24492..25280 [+]
ProductVirB8
Component typeVirB8
UniProt IDQ6J2H3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.1e-47, Aligned region: 43..255
Protein Sequence: 262 a.a.     [Download]
>gi|49188551|ref|YP_025649.1| VirB8 [Pseudomonas syringae pv. maculicola]
MKKFRKSKQDVIDQERQLAARTSIDAATAQDISLAEQAFIHAARYFEKNIAADEKAKTKNARRLAGFFGV
LTFMSIAAVMGLTPLKTVQLGLVRVDNNSGYTDVVWADDKGKPPEQIDDEFWLSTYVRFRESYNFSSHDA
EFGMVELMSYGETFTEYRNFQLSSKGYLEVLGTNRQIRTDINNINFLERKDREGTAQVRLTKTVLDRNGT
PDPQLAPVTWVATVTYDYKNPAKKAGDQWLNPRGFGVKAYTMTQEVGVSNGK
 
Nucleotide Sequence: 789 bp     [Download]
>gi|49188520|ref|NC_005918.1|:24492-25280 Pseudomonas syringae pv. maculicola strain ES4326 plasmid pPMA4326A, complete sequence
ATGAAAAAGTTTCGAAAATCCAAACAGGACGTGATCGATCAGGAGCGGCAACTGGCCGCCCGTACCAGCA
TCGACGCGGCCACCGCACAAGACATCAGCCTGGCCGAACAGGCATTCATCCACGCAGCGCGGTATTTCGA
GAAGAACATCGCCGCCGACGAGAAGGCCAAGACCAAAAACGCCCGTCGCCTGGCGGGCTTCTTCGGTGTG
CTGACCTTTATGTCCATCGCCGCCGTGATGGGCCTGACCCCGCTCAAGACCGTGCAACTGGGCCTGGTAC
GGGTAGACAACAACTCCGGCTACACGGACGTGGTGTGGGCCGACGACAAGGGCAAGCCACCGGAGCAGAT
CGATGACGAGTTCTGGCTCTCGACCTATGTACGGTTTCGCGAGAGCTACAACTTCTCAAGCCACGACGCA
GAGTTCGGCATGGTGGAGCTGATGTCCTACGGCGAGACCTTTACCGAGTACCGCAATTTCCAGCTGTCCT
CCAAGGGCTATCTGGAAGTGCTGGGGACCAACCGGCAAATCCGCACGGATATCAACAATATCAACTTCCT
GGAACGCAAAGATCGGGAAGGCACCGCCCAGGTGCGACTCACCAAAACCGTGCTGGATCGCAACGGCACC
CCCGATCCCCAGTTGGCCCCGGTGACCTGGGTGGCCACGGTGACCTACGACTACAAGAACCCTGCCAAAA
AAGCCGGTGACCAATGGCTAAACCCCCGAGGTTTTGGGGTCAAGGCCTACACGATGACCCAGGAAGTGGG
GGTGTCCAATGGTAAATAA
 Primer design