SecReT4
Protein ID: 49188554
T4SS name [ID]VirB [431]
Gene symbolvirB11
Locus tagPMA4326A34
StrainPseudomonas syringae pv. maculicola plasmid pPMA4326A (NC_005918)
Repliconplasmid pPMA4326A [GenBank: NC_005918] [Browse all T4SS(s) in this replicon]
Location [Strand]27425..28483 [+]
ProductVirB11
Component typeVirB11
UniProt IDQ6J2H0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.3e-39, Aligned region: 33..326
Mg_chelatase [PF01078], Evalue: 2.6e-05, Aligned region: 160..209
Protein Sequence: 352 a.a.     [Download]
>gi|49188554|ref|YP_025652.1| VirB11 [Pseudomonas syringae pv. maculicola]
MTQEPDHSQDPEEQGLTEDTLVLDFLDQAGVTERLNRPGTQDVAINRPFEIWVDGPDGWVREDAPWLTYS
LCWRLANALCALNYRVLAPHSPIHTVELPGGERGQIVMAPACQKGTLSMTFRKPSLLRFTHKDYVNSGRY
DRAQAIASPILALKAWQRDMQEAHAAGDWDRFMEIAVAHRQNIIVFGGPGSGKTTYGKTLIDLFPAHRRM
VTIQEMLEDTLPFHPNHVHLFYGHVVGPKALVACSLRMKPDHLFLSELTGDEVWHFIEILNTGTKGTVTT
AHANDSEAGYARVCGLVKQSEVGKGLDYAYIERLVRTSFDVVVYMEKQDILEVHYEPEYKLALLNGQRQR
AA
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|49188520|ref|NC_005918.1|:27425-28483 Pseudomonas syringae pv. maculicola strain ES4326 plasmid pPMA4326A, complete sequence
ATGACGCAAGAACCAGATCACTCCCAAGACCCAGAGGAACAAGGGCTGACCGAAGACACGCTGGTCCTGG
ACTTTCTCGACCAGGCAGGCGTCACCGAGCGCCTGAATCGCCCCGGCACCCAGGACGTGGCCATTAACCG
GCCCTTTGAAATCTGGGTAGACGGTCCAGACGGCTGGGTGCGCGAGGACGCGCCCTGGCTCACCTACAGC
CTGTGTTGGCGGCTGGCCAATGCGCTCTGTGCGCTGAACTACCGCGTGCTGGCTCCTCATTCACCGATTC
ACACGGTGGAGTTGCCGGGCGGCGAGCGGGGCCAGATCGTCATGGCCCCGGCCTGCCAGAAAGGCACGCT
GTCGATGACGTTTCGCAAACCCTCCTTGCTGCGCTTCACCCACAAGGATTACGTCAACAGTGGCCGCTAT
GATCGGGCCCAGGCCATCGCCTCGCCGATACTGGCCCTCAAAGCCTGGCAGCGCGACATGCAGGAGGCCC
ACGCCGCCGGGGACTGGGACCGGTTCATGGAAATTGCCGTTGCCCATCGCCAGAACATCATCGTGTTCGG
CGGGCCCGGGTCGGGTAAGACCACCTACGGCAAGACGCTGATCGACCTCTTTCCGGCGCATCGGCGCATG
GTCACGATCCAGGAAATGCTGGAAGACACCCTGCCGTTTCATCCCAACCACGTGCATCTGTTCTACGGGC
ATGTGGTGGGCCCTAAAGCCCTGGTGGCCTGCTCGCTGCGCATGAAGCCCGACCACCTGTTTCTGTCCGA
GCTGACGGGCGACGAGGTGTGGCACTTCATCGAGATTCTGAACACCGGCACCAAGGGCACCGTGACCACT
GCGCACGCGAATGACAGTGAAGCAGGCTATGCCCGTGTATGCGGTCTGGTGAAGCAATCGGAGGTCGGCA
AGGGACTGGATTATGCGTACATCGAGCGCCTGGTCCGGACCTCATTCGATGTGGTGGTGTACATGGAAAA
GCAGGACATCCTGGAAGTGCATTACGAACCCGAATACAAGCTGGCCCTGCTCAATGGTCAGCGTCAACGA
GCTGCCTAG
 Primer design